arlS

Accession ARO:3000839
DefinitionArlS is a protein histidine kinase that phosphorylates ArlR, a promoter for norA expression.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, oxazolidinone antibiotic, benzalkonium chloride, phenicol antibiotic, acridine dye, rhodamine, peptide antibiotic, fluoroquinolone antibiotic, antibacterial free fatty acids, macrolide antibiotic, nitroimidazole antibiotic, bicyclomycin, fosfomycin, cephalosporin, nucleoside antibiotic, isoniazid, rifamycin antibiotic, penam, lincosamide antibiotic, diaminopyrimidine antibiotic, glycylcycline
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
ResistomesStaphylococcus aureusg+wgs
Classification36 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Fournier B, et al. 2000. J Bacteriol 182(3): 664-671. Expression of the multidrug resistance transporter NorA from Staphylococcus aureus is modified by a two-component regulatory system. (PMID 10633099)

Resistomes

Prevalence of arlS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0%0.13%
Listeria monocytogenes0%0%0.04%
Staphylococcus aureus99.76%0%99.46%
Staphylococcus pseudintermedius0%0%0.51%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 880


>gb|ABD30512.1|-|arlS [Staphylococcus aureus subsp. aureus NCTC 8325]
MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKPVKDISALDLNASLGNFQEIIIYDEHNNKLF
ETSNDNTVRVEPGYEHRYFDRVIKKRYKGIEYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLE
ESLNISIEEMNRIIKLVEELLELTKGDVNDISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEINKGTTFKII
F


>gb|CP000253.1|-|1360281-1361636|arlS [Staphylococcus aureus subsp. aureus NCTC 8325]
ATGACAAAACGTAAATTGCGCAATAACTGGATTATTGTTACCACGATGATTACGTTTGTCACGATATTTTTGTTTTGTTTAATTATTATT
TTTTTCTTGAAAGATACACTGCATAATAGTGAGCTTGATGATGCAGAACGAAGCTCAAGCGATATTAATAATTTATTTCATTCTAAGCCT
GTTAAAGATATATCTGCATTAGACTTGAATGCATCTTTAGGTAATTTTCAAGAGATAATTATTTATGATGAGCATAATAATAAATTATTT
GAGACATCGAATGATAACACAGTGAGAGTTGAACCAGGTTATGAACACCGTTATTTTGACCGCGTAATAAAAAAACGCTATAAAGGCATT
GAATATTTAATTATTAAAGAACCAATTACAACGCAAGATTTCAAAGGGTATAGCTTGTTAATTCATTCACTAGAAAATTATGATAACATC
GTAAAATCATTGTATATCATTGCGCTGGCATTTGGAGTGATTGCAACAATTATAACTGCCACAATCAGTTATGTATTTTCAACACAAATT
ACTAAACCGCTTGTCAGTTTATCAAATAAAATGATTGAGATTCGACGAGATGGTTTTCAAAATAAATTGCAATTAAATACAAATTATGAA
GAAATAGATAATTTAGCAAATACGTTTAATGAGATGATGAGCCAAATTGAAGAATCATTTAATCAACAAAGACAATTTGTTGAAGATGCG
TCACATGAATTACGAACACCATTACAAATTATTCAAGGTCATTTAAATTTGATTCAGCGATGGGGAAAAAAAGACCCAGCAGTATTAGAA
GAATCGTTAAATATTTCTATTGAAGAAATGAATCGTATCATAAAATTAGTCGAAGAATTACTTGAATTGACTAAAGGAGATGTAAATGAC
ATTTCTTCTGAAGCACAGACCGTGCATATTAATGATGAAATTCGCTCGCGAATACACTCATTAAAACAATTGCATCCTGATTATCAATTT
GATACGGATCTGACATCTAAAAATCTAGAAATTAAAATGAAACCTCATCAATTCGAACAATTATTTTTAATCTTTATTGATAATGCAATC
AAATATGATGTGAAGAATAAGAAAATTAAAGTTAAGACAAGGTTAAAAAATAAGCAAAAAATAATTGAAATTACAGATCATGGAATTGGT
ATTCCAGAGGAAGATCAAGATTTCATTTTTGATCGCTTTTATCGAGTGGATAAATCTCGTTCAAGAAGTCAAGGCGGTAATGGACTCGGA
TTATCTATTGCTCAAAAAATCATTCAATTAAACGGAGGATCGATTAAAATTAAAAGTGAAATTAACAAAGGAACAACGTTTAAAATCATA
TTTTAA