arlS

Accession ARO:3000839
CARD Short NamearlS
DefinitionArlS is a protein histidine kinase that phosphorylates ArlR, a promoter for norA expression.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic, disinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsEnterobacter hormaecheiwgs, Enterococcus faecaliswgs, Escherichia coliwgs, Listeria monocytogeneswgs, Staphylococcus aureusg+wgs, Staphylococcus pseudintermediuswgs
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Fournier B, et al. 2000. J Bacteriol 182(3): 664-671. Expression of the multidrug resistance transporter NorA from Staphylococcus aureus is modified by a two-component regulatory system. (PMID 10633099)

Resistomes

Prevalence of arlS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterobacter hormaechei0%0%0.05%0%
Enterococcus faecalis0%0%0.05%0%
Escherichia coli0%0%0.02%0%
Listeria monocytogenes0%0%0.03%0%
Staphylococcus aureus100%0%58.72%0%
Staphylococcus pseudintermedius0%0%0.26%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 880


>gb|ABD30512.1|-|arlS [Staphylococcus aureus subsp. aureus NCTC 8325]
MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKPVKDISALDLNASLGNFQEIIIYDEHNNKLF
ETSNDNTVRVEPGYEHRYFDRVIKKRYKGIEYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLE
ESLNISIEEMNRIIKLVEELLELTKGDVNDISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEINKGTTFKII
F


>gb|CP000253.1|-|1360281-1361636|arlS [Staphylococcus aureus subsp. aureus NCTC 8325]
ATGACAAAACGTAAATTGCGCAATAACTGGATTATTGTTACCACGATGATTACGTTTGTCACGATATTTTTGTTTTGTTTAATTATTATT
TTTTTCTTGAAAGATACACTGCATAATAGTGAGCTTGATGATGCAGAACGAAGCTCAAGCGATATTAATAATTTATTTCATTCTAAGCCT
GTTAAAGATATATCTGCATTAGACTTGAATGCATCTTTAGGTAATTTTCAAGAGATAATTATTTATGATGAGCATAATAATAAATTATTT
GAGACATCGAATGATAACACAGTGAGAGTTGAACCAGGTTATGAACACCGTTATTTTGACCGCGTAATAAAAAAACGCTATAAAGGCATT
GAATATTTAATTATTAAAGAACCAATTACAACGCAAGATTTCAAAGGGTATAGCTTGTTAATTCATTCACTAGAAAATTATGATAACATC
GTAAAATCATTGTATATCATTGCGCTGGCATTTGGAGTGATTGCAACAATTATAACTGCCACAATCAGTTATGTATTTTCAACACAAATT
ACTAAACCGCTTGTCAGTTTATCAAATAAAATGATTGAGATTCGACGAGATGGTTTTCAAAATAAATTGCAATTAAATACAAATTATGAA
GAAATAGATAATTTAGCAAATACGTTTAATGAGATGATGAGCCAAATTGAAGAATCATTTAATCAACAAAGACAATTTGTTGAAGATGCG
TCACATGAATTACGAACACCATTACAAATTATTCAAGGTCATTTAAATTTGATTCAGCGATGGGGAAAAAAAGACCCAGCAGTATTAGAA
GAATCGTTAAATATTTCTATTGAAGAAATGAATCGTATCATAAAATTAGTCGAAGAATTACTTGAATTGACTAAAGGAGATGTAAATGAC
ATTTCTTCTGAAGCACAGACCGTGCATATTAATGATGAAATTCGCTCGCGAATACACTCATTAAAACAATTGCATCCTGATTATCAATTT
GATACGGATCTGACATCTAAAAATCTAGAAATTAAAATGAAACCTCATCAATTCGAACAATTATTTTTAATCTTTATTGATAATGCAATC
AAATATGATGTGAAGAATAAGAAAATTAAAGTTAAGACAAGGTTAAAAAATAAGCAAAAAATAATTGAAATTACAGATCATGGAATTGGT
ATTCCAGAGGAAGATCAAGATTTCATTTTTGATCGCTTTTATCGAGTGGATAAATCTCGTTCAAGAAGTCAAGGCGGTAATGGACTCGGA
TTATCTATTGCTCAAAAAATCATTCAATTAAACGGAGGATCGATTAAAATTAAAAGTGAAATTAACAAAGGAACAACGTTTAAAATCATA
TTTTAA