OXA-4

Download Sequences

Accession	ARO:3001399
CARD Short Name	OXA-4
Definition	OXA-4 is a beta-lactamase found in Enterobacteriaceae and P. aeruginosa.
AMR Gene Family	OXA beta-lactamase, OXA-1-like beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas veronii^wgs, Burkholderia cenocepacia^g, Escherichia coli^p+wgs, Klebsiella pneumoniae^wgs, Pseudomonas aeruginosa^g+wgs+gi, Salmonella enterica^wgs
Resistomes with Sequence Variants	Aeromonas veronii^wgs, Burkholderia cenocepacia^g, Enterobacter hormaechei^gi, Escherichia coli^p+wgs+gi, Klebsiella huaxiensis^gi, Klebsiella pneumoniae^wgs+gi, Morganella morganii^gi, Pasteurella multocida^gi, Proteus mirabilis^gi, Pseudomonas aeruginosa^g+wgs+gi, Salmonella enterica^wgs+gi, Shigella dysenteriae^gi, Shigella flexneri^gi
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + beta-lactam antibiotic + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + penicillin beta-lactam [Drug Class] + beta-lactamase resistant penicillin + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + class D beta-lactamase + oxacillin [Antibiotic] + OXA beta-lactamase [AMR Gene Family] + cephalosporin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + OXA-1-like beta-lactamase [AMR Gene Family]
Publications	Kingsley SA, et al. 2013. Indian J Microbiol 53(3): 308-314. First Report of OXA-4, an ESBL Isolated from Pseudomonas aeruginosa a South Indian Strain. (PMID 24426128)

Resistomes

Prevalence of OXA-4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Aeromonas veronii	0%	0%	0.56%	0%	0%
Aeromonas veronii	0%	0%	0.56%	0%	0%
Burkholderia cenocepacia	0.5%	0%	0%	0%	0%
Burkholderia cenocepacia	0.5%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0%	6.67%	0%
Enterobacter hormaechei	0%	0%	0%	0%	0%
Escherichia coli	0%	0.01%	0.04%	1.28%	0%
Escherichia coli	0%	0.01%	0.04%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	50%	0%
Klebsiella pneumoniae	0%	0%	0.03%	0%	0%
Klebsiella pneumoniae	0%	0%	0.03%	5.71%	0%
Morganella morganii	0%	0%	0%	0%	0%
Morganella morganii	0%	0%	0%	7.69%	0%
Pasteurella multocida	0%	0%	0%	16.67%	0%
Pasteurella multocida	0%	0%	0%	0%	0%
Proteus mirabilis	0%	0%	0%	0%	0%
Proteus mirabilis	0%	0%	0%	22.22%	0%
Pseudomonas aeruginosa	1.53%	0%	1.01%	8.33%	0%
Pseudomonas aeruginosa	1.53%	0%	1%	4.17%	0%
Salmonella enterica	0%	0%	0.07%	3.64%	0%
Salmonella enterica	0%	0%	0.07%	0%	0%
Shigella dysenteriae	0%	0%	0%	25%	0%
Shigella dysenteriae	0%	0%	0%	0%	0%
Shigella flexneri	0%	0%	0%	16.67%	0%
Shigella flexneri	0%	0%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AET05998.1|+|OXA-4 [Pseudomonas aeruginosa]
MKNTIHINFAIFLIIANIIYSSASASTDISTVASPLFEGTEGCFLLYDVSTNAEIAQFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQK
TIFKWDKTPKGMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLR
KIINHNLPVKNSAIENTIENMYLQDLENSTKLYGKTGAGFTANRTLQNGWFEGFIISKSGHKYVFVSALTGNLGSNLTSSIKAKKNAITI
LNTLNL

>gb|JN129451.1|+|1037-1867|OXA-4 [Pseudomonas aeruginosa]
ATGAAAAACACAATACATATCAACTTCGCTATTTTTTTAATAATTGCAAATATTATCTACAGCAGCGCCAGTGCATCAACAGATATCTCT
ACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGATGTATCCACAAACGCTGAAATTGCTCAATTCAATAAA
GCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGCATTATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAA
ACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGATCTGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTT
TGGGTTTCGCAAGAAATAACCCAAAAAATTGGATTAAATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCT
GGAGATAAAGAAAGAAACAACGGATTAACAGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGT
AAAATTATTAATCACAATCTCCCAGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGAGAATAGTACA
AAACTGTATGGGAAAACTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGA
CATAAATATGTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAGCCAAGAAAAATGCGATCACCATT
CTAAACACACTAAATTTATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

OXA-4

Prevalence: protein homolog model (view sequences)

Graph