CTX-M-14

Download Sequences

Accession	ARO:3001877
Synonym(s)	CTX-M-18
CARD Short Name	CTX-M-14
Definition	CTX-M-14 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene Family	CTX-M beta-lactamase
Drug Class	cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas caviae^g+wgs, Aeromonas hydrophila^g+p, Avibacterium paragallinarum^wgs, Citrobacter amalonaticus^g, Citrobacter freundii^g+wgs, Citrobacter portucalensis^p, Citrobacter youngae^wgs, Cronobacter sakazakii^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^wgs, Klebsiella aerogenes^p+wgs, Klebsiella huaxiensis^g+gi, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^wgs, Proteus mirabilis^g+p+wgs, Salmonella enterica^g+p+wgs+gi, Serratia marcescens^g+wgs+gi, Shigella boydii^wgs, Shigella flexneri^g+p+wgs, Shigella sonnei^wgs, Vibrio alginolyticus^wgs, Vibrio cholerae^g, Vibrio parahaemolyticus^g+wgs
Resistomes with Sequence Variants	Aeromonas caviae^g+wgs, Aeromonas hydrophila^g+p, Avibacterium paragallinarum^wgs, Citrobacter amalonaticus^g, Citrobacter freundii^g+wgs, Citrobacter portucalensis^p, Citrobacter youngae^wgs, Cronobacter sakazakii^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^wgs, Klebsiella aerogenes^p+wgs, Klebsiella huaxiensis^g+gi, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^wgs, Proteus mirabilis^g+p+wgs, Salmonella enterica^g+p+wgs+gi, Serratia marcescens^g+wgs+gi, Shigella boydii^wgs, Shigella flexneri^g+p+wgs, Shigella sonnei^wgs, Vibrio alginolyticus^wgs, Vibrio cholerae^g, Vibrio parahaemolyticus^g+wgs
Classification	13 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + cephem + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + class A beta-lactamase + cephalosporin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + CTX-M beta-lactamase [AMR Gene Family]
Sub-Term(s)	5 ontology terms \| Show + tazobactam [Adjuvant] is_small_molecule_inhibitor + clavulanic acid [Adjuvant] is_small_molecule_inhibitor + vaborbactam [Adjuvant] is_small_molecule_inhibitor + Xeruborbactam [Adjuvant] is_small_molecule_inhibitor + nacubactam [Adjuvant] is_small_molecule_inhibitor
Publications	Chanawong A, et al. 2002. Antimicrob Agents Chemother 46(3): 630-637. Three cefotaximases, CTX-M-9, CTX-M-13, and CTX-M-14, among Enterobacteriaceae in the People's Republic of China. (PMID 11850241)

Resistomes

Prevalence of CTX-M-14 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas caviae	4.55%	0%	0.54%	0%
Aeromonas caviae	4.55%	0%	0.54%	0%
Aeromonas hydrophila	1.54%	1.3%	0%	0%
Aeromonas hydrophila	1.54%	1.3%	0%	0%
Avibacterium paragallinarum	0%	0%	2.94%	0%
Avibacterium paragallinarum	0%	0%	2.94%	0%
Citrobacter amalonaticus	9.09%	0%	0%	0%
Citrobacter amalonaticus	9.09%	0%	0%	0%
Citrobacter freundii	0.82%	0%	0.77%	0%
Citrobacter freundii	0.82%	0%	0.77%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Cronobacter sakazakii	0%	0%	0.22%	0%
Cronobacter sakazakii	0%	0%	0.22%	0%
Enterobacter asburiae	0%	0%	1.19%	0%
Enterobacter asburiae	0%	0%	1.19%	0%
Enterobacter chengduensis	0%	0%	4%	0%
Enterobacter chengduensis	0%	0%	4%	0%
Enterobacter cloacae	0%	0.56%	0.96%	0%
Enterobacter cloacae	0%	0.56%	0.96%	0%
Enterobacter hormaechei	0.36%	0.13%	0.69%	0%
Enterobacter hormaechei	0.36%	0.13%	0.69%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Escherichia albertii	0%	0%	0.65%	0%
Escherichia albertii	0%	0%	0.65%	0%
Escherichia coli	1.55%	0.81%	2.87%	0.26%
Escherichia coli	1.55%	0.81%	2.86%	0.26%
Escherichia fergusonii	0%	0%	2.17%	0%
Escherichia fergusonii	0%	0%	2.17%	0%
Klebsiella aerogenes	0%	1.09%	0.56%	0%
Klebsiella aerogenes	0%	1.09%	0.56%	0%
Klebsiella huaxiensis	100%	0%	0%	50%
Klebsiella huaxiensis	100%	0%	0%	50%
Klebsiella michiganensis	0%	1.14%	0.53%	0%
Klebsiella michiganensis	0%	1.14%	0.53%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%
Klebsiella pneumoniae	0.53%	1.14%	2.26%	0%
Klebsiella pneumoniae	0.53%	1.14%	2.28%	0%
Klebsiella quasipneumoniae	0%	0.21%	2.76%	0%
Klebsiella quasipneumoniae	0%	0.21%	2.76%	0%
Leclercia adecarboxylata	0%	0%	4.65%	0%
Leclercia adecarboxylata	0%	0%	4.65%	0%
Proteus mirabilis	5.5%	3.75%	1.49%	0%
Proteus mirabilis	5.5%	3.75%	1.49%	0%
Salmonella enterica	0.5%	1.64%	0.24%	0.33%
Salmonella enterica	0.5%	1.64%	0.24%	0.33%
Serratia marcescens	2.27%	0%	3.01%	11.11%
Serratia marcescens	2.27%	0%	3.01%	11.11%
Shigella boydii	0%	0%	4.44%	0%
Shigella boydii	0%	0%	4.44%	0%
Shigella flexneri	1%	0.8%	3.42%	0%
Shigella flexneri	1%	0.8%	3.42%	0%
Shigella sonnei	0%	0%	0.73%	0%
Shigella sonnei	0%	0%	0.73%	0%
Vibrio alginolyticus	0%	0%	0.4%	0%
Vibrio alginolyticus	0%	0%	0.4%	0%
Vibrio cholerae	0.45%	0%	0%	0%
Vibrio cholerae	0.45%	0%	0%	0%
Vibrio parahaemolyticus	0.32%	0%	0.21%	0%
Vibrio parahaemolyticus	0.32%	0%	0.21%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAF72530.1|+|CTX-M-14 [Escherichia coli]
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQ
KQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP
RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQ
QNAESRRDVLASAARIIAEGL

>gb|AF252622.2|+|1741-2616|CTX-M-14 [Escherichia coli]
ATGGTGACAAAGAGAGTGCAACGGATGATGTTCGCGGCGGCGGCGTGCATTCCGCTGCTGCTGGGCAGCGCGCCGCTTTATGCGCAGACG
AGTGCGGTGCAGCAAAAGCTGGCGGCGCTGGAGAAAAGCAGCGGAGGGCGGCTGGGCGTCGCGCTCATCGATACCGCAGATAATACGCAG
GTGCTTTATCGCGGTGATGAACGCTTTCCAATGTGCAGTACCAGTAAAGTTATGGCGGCCGCGGCGGTGCTTAAGCAGAGTGAAACGCAA
AAGCAGCTGCTTAATCAGCCTGTCGAGATCAAGCCTGCCGATCTGGTTAACTACAATCCGATTGCCGAAAAACACGTCAACGGCACAATG
ACGCTGGCAGAACTGAGCGCGGCCGCGTTGCAGTACAGCGACAATACCGCCATGAACAAATTGATTGCCCAGCTCGGTGGCCCGGGAGGC
GTGACGGCTTTTGCCCGCGCGATCGGCGATGAGACGTTTCGTCTGGATCGCACTGAACCTACGCTGAATACCGCCATTCCCGGCGACCCG
AGAGACACCACCACGCCGCGGGCGATGGCGCAGACGTTGCGTCAGCTTACGCTGGGTCATGCGCTGGGCGAAACCCAGCGGGCGCAGTTG
GTGACGTGGCTCAAAGGCAATACGACCGGCGCAGCCAGCATTCGGGCCGGCTTACCGACGTCGTGGACTGTGGGTGATAAGACCGGCAGC
GGCGACTACGGCACCACCAATGATATTGCGGTGATCTGGCCGCAGGGTCGTGCGCCGCTGGTTCTGGTGACCTATTTTACCCAGCCGCAA
CAGAACGCAGAGAGCCGCCGCGATGTGCTGGCTTCAGCGGCGAGAATCATCGCCGAAGGGCTGTAA

CTX-M-14

Prevalence: protein homolog model (view sequences)

Graph