AAC(3)-IIc

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002535
Synonym(s)aacC2
CARD Short NameAAC(3)-IIc
DefinitionAAC(3)-IIc is a plasmid-encoded aminoglycoside acetyltransferase in E. coli and P. aeruginosa.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 6'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(3)-II
Resistomes with Sequence VariantsAcinetobacter baumanniip+wgs+gi, Acinetobacter indicusp, Acinetobacter johnsoniip, Acinetobacter juniip, Acinetobacter pittiip, Acinetobacter townerip, Aeromonas caviaep, Brucella intermediawgs, Citrobacter freundiip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter hormaecheiwgs+gi, Escherichia colig+p+wgs+gi, Escherichia fergusoniip, Klebsiella aerogenesp, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs+gi, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs+gi, Paracoccus denitrificanswgs, Proteus mirabiliswgs+gi, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Serratia marcescenswgs, Shigella flexnerip, Shigella sonneiwgs, Stenotrophomonas maltophiliawgs, Vibrio choleraep+wgs
Publications

Dubois V, et al. 2008. J Antimicrob Chemother 62(2): 316-323. Beta-lactam and aminoglycoside resistance rates and mechanisms among Pseudomonas aeruginosa in French general practice (community and private healthcare centres). (PMID 18467306)

Shaw KJ, et al. 1993. Microbiol Rev 57(1): 138-163. Molecular genetics of aminoglycoside resistance genes and familial relationships of the aminoglycoside-modifying enzymes. (PMID 8385262)

Resistomes

Prevalence of AAC(3)-IIc among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0.47%0.35%1.89%0%
Acinetobacter indicus0%3.77%0%0%0%
Acinetobacter johnsonii0%1.39%0%0%0%
Acinetobacter junii0%16.67%0%0%0%
Acinetobacter pittii0%0.99%0%0%0%
Acinetobacter towneri0%12.5%0%0%0%
Aeromonas caviae0%1.3%0%0%0%
Brucella intermedia0%0%5.41%0%0%
Citrobacter freundii0%0.62%1.74%0%0%
Citrobacter portucalensis0%1.47%0.9%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Enterobacter hormaechei0%0%0.56%6.67%0%
Escherichia coli0.12%0.13%0.35%0.89%0.04%
Escherichia fergusonii0%0.36%0%0%0%
Klebsiella aerogenes0%2.17%0%0%0%
Klebsiella oxytoca0%0.68%0.42%0%0%
Klebsiella pneumoniae0%0.23%0.82%1.9%0%
Klebsiella quasipneumoniae0%0%0.79%0%0%
Morganella morganii0%0%0.61%7.69%0%
Paracoccus denitrificans0%0%16.67%0%0%
Proteus mirabilis0%0%0.33%7.41%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Salmonella enterica0%0.16%0.03%0%0%
Serratia marcescens0%0%0.13%0%0%
Shigella flexneri0%0.8%0%0%0%
Shigella sonnei0%0%0.07%0%0%
Stenotrophomonas maltophilia0%0%0.89%0%0%
Vibrio cholerae0%5.26%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|CAA38525.1|+|AAC(3)-IIc [Escherichia coli]
MHTRKAITEALQKLGVQTGDLLMVHASLKAIGPVEGGAETVVAALRSAVGPTGTVMGYASWDRSPYEETRNGARLDDKTRRTWPPFDPAT
AGTYRGFGLLNQFLVQAPGARRSAHPDASMVAVGPLAETLTEPHKLGHALGEGSPVERFVRLGGKALLLGAPLNSVTALHYAEAVADIPN
KRRVTYEMPMLGSNGEVAWKTASDYDSNGILDCFAIEGKPDAVETIANAYVKLGRHREGVVGFAQCYLFDAQDIVTFGVTYLEKHFGTTP
IVPAHEVAECSCEPSG


>gb|X54723.1|+|819-1679|AAC(3)-IIc [Escherichia coli]
ATGCATACGCGGAAGGCAATAACGGAGGCGCTTCAAAAACTCGGAGTCCAAACCGGTGACCTATTGATGGTGCATGCCTCACTTAAAGCG
ATTGGTCCGGTCGAAGGAGGAGCGGAGACGGTCGTTGCCGCGTTACGCTCCGCGGTTGGGCCGACTGGCACTGTGATGGGATACGCATCG
TGGGACCGATCACCCTACGAGGAGACTCGTAATGGCGCTCGGTTGGATGACAAAACCCGCCGTACCTGGCCGCCGTTCGATCCCGCAACG
GCCGGGACTTACCGTGGGTTCGGCCTGCTGAATCAGTTTCTGGTTCAAGCCCCCGGCGCGCGGCGCAGCGCGCACCCCGATGCATCGATG
GTCGCGGTTGGTCCACTGGCTGAAACGCTGACGGAGCCTCACAAGCTCGGTCACGCCTTGGGGGAAGGGTCGCCCGTCGAGCGGTTCGTT
CGCCTTGGCGGGAAGGCCCTGCTGTTGGGTGCGCCGCTAAACTCCGTTACCGCATTGCACTACGCCGAGGCGGTTGCCGATATCCCCAAC
AAACGGCGGGTGACGTATGAGATGCCGATGCTTGGAAGCAACGGCGAAGTCGCCTGGAAAACGGCATCGGATTACGATTCAAACGGCATT
CTCGATTGCTTTGCTATCGAAGGAAAGCCGGATGCGGTCGAAACTATAGCAAATGCTTACGTGAAGCTCGGTCGCCATCGAGAAGGTGTC
GTGGGCTTTGCTCAGTGCTACCTGTTCGACGCGCAGGACATCGTGACGTTCGGCGTCACCTATCTTGAGAAGCATTTCGGAACCACTCCG
ATCGTGCCAGCACACGAAGTCGCCGAGTGCTCTTGCGAGCCTTCAGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit