AAC(6')-32

Accession ARO:3002586
CARD Short NameAAC(6')-32
DefinitionAAC(6')-32 is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesPseudomonas aeruginosawgs
Resistomes with Sequence VariantsBurkholderia cenocepaciawgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosawgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
Publications

Gutierrez O, et al. 2007. Antimicrob Agents Chemother 51(12): 4329-4335. Molecular epidemiology and mechanisms of carbapenem resistance in Pseudomonas aeruginosa isolates from Spanish hospitals. (PMID 17938181)

Resistomes

Prevalence of AAC(6')-32 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Burkholderia cenocepacia0%0%0.53%0%
Klebsiella pneumoniae0%0%0.02%0%
Pseudomonas aeruginosa0%0%0.02%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|ABR10839.1|+|AAC(6')-32 [Pseudomonas aeruginosa]
MSPSKTPVTLRLMTERDLPMLHAWLNRPHIVEWWGGEEERPTLHEVVKHYLPRVLAEEAVTPYIAMLGDEPIGYAQSYVALGSGDGWWED
ETDPGVRGIDQFLSNHTQLNQGLGTKLVQALVELLFSDPTVTKIQTDPAPNNHRAIRCYEKAGFVQQNVITTPDGPAVYMVQTRQAFERV
RSAA


>gb|EF614235.1|+|2247-2801|AAC(6')-32 [Pseudomonas aeruginosa]
ATGTCCCCGAGCAAAACACCCGTTACCTTGCGCCTCATGACCGAGCGCGACCTACCGATGCTGCATGCATGGCTGAACCGGCCGCACATT
GTCGAGTGGTGGGGTGGAGAAGAAGAACGCCCGACTCTTCATGAAGTGGTCAAACACTACCTGCCGAGGGTTTTGGCAGAAGAAGCCGTC
ACACCATACATCGCGATGTTGGGCGACGAACCCATCGGCTACGCTCAGTCATACGTCGCACTCGGAAGCGGTGATGGATGGTGGGAGGAT
GAAACCGACCCAGGCGTACGAGGGATAGACCAATTCCTGTCGAACCATACACAGTTGAACCAGGGCCTAGGTACAAAGCTCGTCCAGGCA
CTCGTTGAACTGCTGTTCTCAGATCCTACCGTGACGAAGATCCAAACCGACCCGGCGCCAAACAACCATCGAGCGATTCGCTGCTACGAG
AAAGCTGGCTTTGTTCAGCAAAACGTCATCACCACACCAGACGGCCCAGCCGTCTACATGGTTCAAACCAGGCAGGCCTTCGAGCGTGTG
CGCAGTGCTGCCTAA