AAC(6')-IIa

Accession ARO:3002594
CARD Short NameAAC(6')-IIa
DefinitionAAC(6')-IIa is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa and S. enterica.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAchromobacter xylosoxidanswgs, Acinetobacter pittiiwgs, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg+wgs, Aeromonas hydrophilap, Aeromonas veroniiwgs, Alcaligenes faecalisg, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colip, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Proteus mirabiliswgs, Pseudomonas aeruginosap+wgs, Pseudomonas monteiliig, Pseudomonas putidawgs, Pseudomonas stutzerig, Shewanella putrefacienswgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter baumanniiwgs, Acinetobacter pittiiwgs, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg+wgs, Aeromonas hydrophilap, Aeromonas veroniiwgs, Alcaligenes faecalisg, Burkholderia cenocepaciag, Burkholderia cepaciawgs, Burkholderia vietnamiensiswgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Proteus mirabiliswgs, Pseudomonas aeruginosap+wgs, Pseudomonas monteiliig, Pseudomonas putidag+wgs, Pseudomonas stutzerig, Raoultella planticolap, Serratia marcescenswgs, Shewanella putrefacienswgs, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
Publications

Shaw KJ, et al. 1989. Antimicrob Agents Chemother 33(12): 2052-2062. Isolation, characterization, and DNA sequence analysis of an AAC(6')-II gene from Pseudomonas aeruginosa. (PMID 2515793)

Resistomes

Prevalence of AAC(6')-IIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Achromobacter xylosoxidans0%0%1.63%0%
Acinetobacter baumannii0%0%0.03%0%
Acinetobacter pittii0%0%0.33%0%
Actinobacillus pleuropneumoniae3.03%0%0%0%
Aeromonas caviae3.23%0%8.97%0%
Aeromonas hydrophila0%2.22%0%0%
Aeromonas veronii0%0%1.92%0%
Alcaligenes faecalis6.25%0%0%0%
Burkholderia cenocepacia0.5%0%0%0%
Burkholderia cepacia0%0%0.45%0%
Burkholderia vietnamiensis0%0%0.86%0%
Enterobacter hormaechei0%0%0.23%0%
Enterobacter kobei0%0%1.55%0%
Enterobacter roggenkampii0%0%0.4%0%
Escherichia coli0%0.01%0.01%0%
Klebsiella michiganensis0%0%0.6%0%
Klebsiella oxytoca0%0%0.98%0%
Klebsiella pneumoniae0.15%0%0.03%0%
Laribacter hongkongensis0%0%2.08%0%
Leclercia adecarboxylata0%0%5%0%
Proteus mirabilis0%0%0.27%0%
Pseudomonas aeruginosa0%1.28%0.32%0%
Pseudomonas monteilii22.22%0%0%0%
Pseudomonas putida2%0%2.05%0%
Pseudomonas stutzeri3.23%0%0%0%
Raoultella planticola0%2.86%0%0%
Serratia marcescens0%0%0.28%0%
Shewanella putrefaciens0%0%9.09%0%
Vibrio alginolyticus0%0%1.33%0%
Vibrio cholerae0%0%0.14%0%
Vibrio parahaemolyticus0%0%0.31%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAM92464.1|+|AAC(6')-IIa [Salmonella enterica subsp. enterica serovar Typhi]
MSASTPPITLRLMTERDLPMLHDWLNRPHIVEWWGGDEERPTLDEVLEHYLPRAMAEESVTPYIAMLGEEPIGYAQSYVALGSGDGWWED
ETDPGVRGIDQSLADPTQLNKGLGTRLVRALVELLFSDPTVTKIQTDPTPNNHRAIRCYEKAGFVREKIITTPDGPAVYMVQTRQAFERK
RGVA


>gb|AY123251.1|+|2951-3505|AAC(6')-IIa [Salmonella enterica subsp. enterica serovar Typhi]
ATGTCCGCGAGCACCCCCCCCATAACTCTTCGCCTCATGACCGAGCGCGACCTGCCGATGCTCCATGATTGGCTCAACCGGCCGCACATC
GTTGAGTGGTGGGGTGGTGACGAAGAGCGACCGACTCTTGATGAAGTGCTGGAACACTACCTGCCCAGAGCGATGGCGGAAGAGTCCGTA
ACACCGTACATCGCAATGCTGGGCGAGGAACCGATCGGCTATGCTCAGTCGTACGTCGCGCTCGGAAGCGGTGATGGCTGGTGGGAAGAT
GAAACTGATCCAGGAGTGCGAGGAATAGACCAGTCTCTGGCTGACCCGACACAGTTGAACAAAGGCCTAGGAACAAGGCTTGTCCGCGCT
CTCGTTGAACTACTGTTCTCGGACCCCACCGTGACGAAGATTCAGACCGACCCGACTCCGAACAACCATCGAGCCATACGCTGCTATGAG
AAGGCAGGATTCGTGCGGGAGAAGATCATCACCACGCCTGACGGGCCGGCGGTTTACATGGTTCAAACACGACAAGCCTTCGAGAGAAAG
CGCGGTGTTGCCTAA