AAC(6')-IIa

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002594
CARD Short NameAAC(6')-IIa
DefinitionAAC(6')-IIa is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa and S. enterica.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 5-episisomicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(6')-II
Resistomes with Perfect MatchesAchromobacter xylosoxidanswgs, Acinetobacter pittiiwgs, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg+wgs, Aeromonas hydrophilap, Aeromonas veroniig+wgs, Alcaligenes faecalisg+gi, Bordetella trematumgi, Citrobacter freundiiwgs, Ectopseudomonas mendocinag+p, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colip, Klebsiella michiganensisg+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Proteus mirabiliswgs, Pseudomonas aeruginosap+wgs, Pseudomonas monteiliig+gi, Pseudomonas putidag+wgs, Stenotrophomonas maltophiliawgs, Stutzerimonas stutzerig, Vibrio choleraewgs
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter baumanniiwgs, Acinetobacter pittiiwgs, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilap, Aeromonas veroniig+wgs, Alcaligenes faecalisg+gi, Bordetella trematumgi, Burkholderia cenocepaciag, Burkholderia cepaciawgs, Burkholderia vietnamiensiswgs, Citrobacter freundiiwgs, Ectopseudomonas mendocinag+p, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip, Klebsiella michiganensisg+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Proteus mirabiliswgs, Pseudomonas aeruginosap+wgs, Pseudomonas monteiliig+gi, Pseudomonas putidag+wgs, Serratia marcescenswgs, Stenotrophomonas maltophiliawgs, Stutzerimonas stutzerig, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Publications

Shaw KJ, et al. 1989. Antimicrob Agents Chemother 33(12): 2052-2062. Isolation, characterization, and DNA sequence analysis of an AAC(6')-II gene from Pseudomonas aeruginosa. (PMID 2515793)

Resistomes

Prevalence of AAC(6')-IIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter xylosoxidans0%0%0.76%0%0%
Acinetobacter baumannii0%0%0.03%0%0%
Acinetobacter pittii0%0%0.28%0%0%
Actinobacillus pleuropneumoniae2.78%0%0%0%0%
Aeromonas caviae4.55%1.3%6.99%0%0%
Aeromonas hydrophila0%1.3%0%0%0%
Aeromonas veronii1.82%0%1.69%0%0%
Alcaligenes faecalis5%0%0%33.33%0%
Bordetella trematum0%0%0%50%0%
Burkholderia cenocepacia0.5%0%0%0%0%
Burkholderia cepacia0%0%0.45%0%0%
Burkholderia vietnamiensis0%0%0.86%0%0%
Citrobacter freundii0%0%0.39%0%0%
Ectopseudomonas mendocina12.5%50%0%0%0%
Enterobacter hormaechei0%0%0.35%0%0%
Enterobacter kobei0%0%1.75%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli0%0.01%0%0%0%
Klebsiella michiganensis1.61%0%1.06%0%0%
Klebsiella oxytoca0%0%1.26%0%0%
Klebsiella pneumoniae0.12%0%0.03%0%0%
Laribacter hongkongensis0%0%2.08%0%0%
Leclercia adecarboxylata0%0%2.33%0%0%
Proteus mirabilis0%0%0.33%0%0%
Pseudomonas aeruginosa0%2.05%0.77%0%0%
Pseudomonas monteilii22.22%0%0%100%0%
Pseudomonas putida2.82%0%6.42%0%0%
Serratia marcescens0%0%0.26%0%0%
Stenotrophomonas maltophilia0%0%0.15%0%0%
Stutzerimonas stutzeri7.14%0%0%0%0%
Vibrio alginolyticus0%0%2.78%0%0%
Vibrio cholerae0%0%0.32%0%0%
Vibrio parahaemolyticus0%0%1.49%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAM92464.1|+|AAC(6')-IIa [Salmonella enterica subsp. enterica serovar Typhi]
MSASTPPITLRLMTERDLPMLHDWLNRPHIVEWWGGDEERPTLDEVLEHYLPRAMAEESVTPYIAMLGEEPIGYAQSYVALGSGDGWWED
ETDPGVRGIDQSLADPTQLNKGLGTRLVRALVELLFSDPTVTKIQTDPTPNNHRAIRCYEKAGFVREKIITTPDGPAVYMVQTRQAFERK
RGVA


>gb|AY123251.1|+|2951-3505|AAC(6')-IIa [Salmonella enterica subsp. enterica serovar Typhi]
ATGTCCGCGAGCACCCCCCCCATAACTCTTCGCCTCATGACCGAGCGCGACCTGCCGATGCTCCATGATTGGCTCAACCGGCCGCACATC
GTTGAGTGGTGGGGTGGTGACGAAGAGCGACCGACTCTTGATGAAGTGCTGGAACACTACCTGCCCAGAGCGATGGCGGAAGAGTCCGTA
ACACCGTACATCGCAATGCTGGGCGAGGAACCGATCGGCTATGCTCAGTCGTACGTCGCGCTCGGAAGCGGTGATGGCTGGTGGGAAGAT
GAAACTGATCCAGGAGTGCGAGGAATAGACCAGTCTCTGGCTGACCCGACACAGTTGAACAAAGGCCTAGGAACAAGGCTTGTCCGCGCT
CTCGTTGAACTACTGTTCTCGGACCCCACCGTGACGAAGATTCAGACCGACCCGACTCCGAACAACCATCGAGCCATACGCTGCTATGAG
AAGGCAGGATTCGTGCGGGAGAAGATCATCACCACGCCTGACGGGCCGGCGGTTTACATGGTTCAAACACGACAAGCCTTCGAGAGAAAG
CGCGGTGTTGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit