AAC(6')-IIa

Download Sequences

Accession	ARO:3002594
CARD Short Name	AAC(6')-IIa
Definition	AAC(6')-IIa is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa and S. enterica.
AMR Gene Family	AAC(6')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Achromobacter xylosoxidans^wgs, Acinetobacter pittii^wgs, Actinobacillus pleuropneumoniae^g, Aeromonas caviae^g+wgs, Aeromonas hydrophila^p, Aeromonas veronii^g+wgs, Alcaligenes faecalis^g+gi, Bordetella trematum^gi, Citrobacter freundii^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Escherichia coli^p, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+wgs, Laribacter hongkongensis^wgs, Leclercia adecarboxylata^wgs, Proteus mirabilis^wgs, Pseudomonas aeruginosa^p+wgs, Pseudomonas mendocina^g+p, Pseudomonas monteilii^g+gi, Pseudomonas putida^g+wgs, Pseudomonas stutzeri^g, Stenotrophomonas maltophilia^wgs, Vibrio cholerae^wgs
Resistomes with Sequence Variants	Achromobacter xylosoxidans^wgs, Acinetobacter baumannii^wgs, Acinetobacter pittii^wgs, Actinobacillus pleuropneumoniae^g, Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^p, Aeromonas veronii^g+wgs, Alcaligenes faecalis^g+gi, Bordetella trematum^gi, Burkholderia cenocepacia^g, Burkholderia cepacia^wgs, Burkholderia vietnamiensis^wgs, Citrobacter freundii^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+wgs, Laribacter hongkongensis^wgs, Leclercia adecarboxylata^wgs, Proteus mirabilis^wgs, Pseudomonas aeruginosa^p+wgs, Pseudomonas mendocina^g+p, Pseudomonas monteilii^g+gi, Pseudomonas putida^g+wgs, Pseudomonas stutzeri^g, Serratia marcescens^wgs, Stenotrophomonas maltophilia^wgs, Vibrio alginolyticus^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + antibiotic mixture + AAC(6') [AMR Gene Family]
Parent Term(s)	8 ontology terms \| Show + confers_resistance_to_antibiotic dibekacin [Antibiotic] + confers_resistance_to_antibiotic sisomicin [Antibiotic] + confers_resistance_to_antibiotic netilmicin [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic] + confers_resistance_to_antibiotic 5-episisomicin [Antibiotic] + confers_resistance_to_antibiotic gentamicin [Antibiotic] + AAC(6')-II
Publications	Shaw KJ, et al. 1989. Antimicrob Agents Chemother 33(12): 2052-2062. Isolation, characterization, and DNA sequence analysis of an AAC(6')-II gene from Pseudomonas aeruginosa. (PMID 2515793)

Resistomes

Prevalence of AAC(6')-IIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Achromobacter xylosoxidans	0%	0%	0.76%	0%	0%
Achromobacter xylosoxidans	0%	0%	0.76%	0%	0%
Acinetobacter baumannii	0%	0%	0.03%	0%	0%
Acinetobacter baumannii	0%	0%	0%	0%	0%
Acinetobacter pittii	0%	0%	0.28%	0%	0%
Acinetobacter pittii	0%	0%	0.28%	0%	0%
Actinobacillus pleuropneumoniae	2.78%	0%	0%	0%	0%
Actinobacillus pleuropneumoniae	2.78%	0%	0%	0%	0%
Aeromonas caviae	4.55%	0%	6.99%	0%	0%
Aeromonas caviae	4.55%	1.3%	6.99%	0%	0%
Aeromonas hydrophila	0%	1.3%	0%	0%	0%
Aeromonas hydrophila	0%	1.3%	0%	0%	0%
Aeromonas veronii	1.82%	0%	1.69%	0%	0%
Aeromonas veronii	1.82%	0%	1.69%	0%	0%
Alcaligenes faecalis	5%	0%	0%	33.33%	0%
Alcaligenes faecalis	5%	0%	0%	33.33%	0%
Bordetella trematum	0%	0%	0%	50%	0%
Bordetella trematum	0%	0%	0%	50%	0%
Burkholderia cenocepacia	0.5%	0%	0%	0%	0%
Burkholderia cenocepacia	0%	0%	0%	0%	0%
Burkholderia cepacia	0%	0%	0%	0%	0%
Burkholderia cepacia	0%	0%	0.45%	0%	0%
Burkholderia vietnamiensis	0%	0%	0.86%	0%	0%
Burkholderia vietnamiensis	0%	0%	0%	0%	0%
Citrobacter freundii	0%	0%	0.39%	0%	0%
Citrobacter freundii	0%	0%	0.39%	0%	0%
Enterobacter hormaechei	0%	0%	0.3%	0%	0%
Enterobacter hormaechei	0%	0%	0.35%	0%	0%
Enterobacter kobei	0%	0%	1.31%	0%	0%
Enterobacter kobei	0%	0%	1.75%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Escherichia coli	0%	0.01%	0%	0%	0%
Escherichia coli	0%	0.01%	0%	0%	0%
Klebsiella michiganensis	1.61%	0%	1.06%	0%	0%
Klebsiella michiganensis	1.61%	0%	1.06%	0%	0%
Klebsiella oxytoca	0%	0%	1.26%	0%	0%
Klebsiella oxytoca	0%	0%	1.26%	0%	0%
Klebsiella pneumoniae	0.12%	0%	0.01%	0%	0%
Klebsiella pneumoniae	0.12%	0%	0.03%	0%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%	0%
Leclercia adecarboxylata	0%	0%	2.33%	0%	0%
Leclercia adecarboxylata	0%	0%	2.33%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0.33%	0%	0%
Pseudomonas aeruginosa	0%	2.05%	0.77%	0%	0%
Pseudomonas aeruginosa	0%	2.05%	0.61%	0%	0%
Pseudomonas mendocina	12.5%	50%	0%	0%	0%
Pseudomonas mendocina	12.5%	50%	0%	0%	0%
Pseudomonas monteilii	22.22%	0%	0%	100%	0%
Pseudomonas monteilii	22.22%	0%	0%	100%	0%
Pseudomonas putida	1.41%	0%	5.88%	0%	0%
Pseudomonas putida	2.82%	0%	6.42%	0%	0%
Pseudomonas stutzeri	7.14%	0%	0%	0%	0%
Pseudomonas stutzeri	7.14%	0%	0%	0%	0%
Serratia marcescens	0%	0%	0.26%	0%	0%
Serratia marcescens	0%	0%	0%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0.15%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0.15%	0%	0%
Vibrio alginolyticus	0%	0%	0%	0%	0%
Vibrio alginolyticus	0%	0%	2.78%	0%	0%
Vibrio cholerae	0%	0%	0.32%	0%	0%
Vibrio cholerae	0%	0%	0.32%	0%	0%
Vibrio parahaemolyticus	0%	0%	1.49%	0%	0%
Vibrio parahaemolyticus	0%	0%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275

Protein
DNA

>gb|AAM92464.1|+|AAC(6')-IIa [Salmonella enterica subsp. enterica serovar Typhi]
MSASTPPITLRLMTERDLPMLHDWLNRPHIVEWWGGDEERPTLDEVLEHYLPRAMAEESVTPYIAMLGEEPIGYAQSYVALGSGDGWWED
ETDPGVRGIDQSLADPTQLNKGLGTRLVRALVELLFSDPTVTKIQTDPTPNNHRAIRCYEKAGFVREKIITTPDGPAVYMVQTRQAFERK
RGVA

>gb|AY123251.1|+|2951-3505|AAC(6')-IIa [Salmonella enterica subsp. enterica serovar Typhi]
ATGTCCGCGAGCACCCCCCCCATAACTCTTCGCCTCATGACCGAGCGCGACCTGCCGATGCTCCATGATTGGCTCAACCGGCCGCACATC
GTTGAGTGGTGGGGTGGTGACGAAGAGCGACCGACTCTTGATGAAGTGCTGGAACACTACCTGCCCAGAGCGATGGCGGAAGAGTCCGTA
ACACCGTACATCGCAATGCTGGGCGAGGAACCGATCGGCTATGCTCAGTCGTACGTCGCGCTCGGAAGCGGTGATGGCTGGTGGGAAGAT
GAAACTGATCCAGGAGTGCGAGGAATAGACCAGTCTCTGGCTGACCCGACACAGTTGAACAAAGGCCTAGGAACAAGGCTTGTCCGCGCT
CTCGTTGAACTACTGTTCTCGGACCCCACCGTGACGAAGATTCAGACCGACCCGACTCCGAACAACCATCGAGCCATACGCTGCTATGAG
AAGGCAGGATTCGTGCGGGAGAAGATCATCACCACGCCTGACGGGCCGGCGGTTTACATGGTTCAAACACGACAAGCCTTCGAGAGAAAG
CGCGGTGTTGCCTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

AAC(6')-IIa

Prevalence: protein homolog model (view sequences)

Graph