AAC(6')-IIc

Accession ARO:3002596
CARD Short NameAAC(6')-IIc
DefinitionAAC(6')-IIc is an aminoglycoside acetyltransferase encoded by plasmids and integrons in E. cloacae.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAeromonas veroniip, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosawgs, Pseudomonas chlororaphiswgs, Pseudomonas putidawgs, Salmonella entericap+wgs, Serratia marcescensp+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas veroniip, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter youngaewgs, Comamonas testosteronip, Cronobacter malonaticuswgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosawgs, Pseudomonas chlororaphiswgs, Pseudomonas putidawgs, Salmonella entericap+wgs+gi, Serratia marcescensp+wgs
Classification12 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic 5-episisomicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ AAC(6')-II
Publications

Galani I, et al. 2005. J Antimicrob Chemother 55(5): 634-638. Characterization of a new integron containing bla(VIM-1) and aac(6')-IIc in an Enterobacter cloacae clinical isolate from Greece. (PMID 15761066)

Resistomes

Prevalence of AAC(6')-IIc among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.01%0%
Aeromonas veronii0%1.54%0%0%
Citrobacter amalonaticus0%0%1.82%0%
Citrobacter freundii0%0%2.32%0%
Citrobacter koseri0%0%0.9%0%
Citrobacter portucalensis0%1.47%0.9%0%
Citrobacter youngae0%0%6.25%0%
Comamonas testosteroni0%50%0%0%
Cronobacter malonaticus0%0%1.82%0%
Enterobacter asburiae6.45%1.38%7.51%0%
Enterobacter chengduensis0%0%12%0%
Enterobacter cloacae0%1.12%6.07%0%
Enterobacter hormaechei0.72%5.15%11.83%0%
Enterobacter kobei0%0%5.68%0%
Enterobacter roggenkampii0%0%0.72%0%
Escherichia coli0%0%0.06%0%
Klebsiella aerogenes0%0%0.28%0%
Klebsiella michiganensis0%0.57%0.27%0%
Klebsiella oxytoca0%0%1.26%0%
Klebsiella pneumoniae0%0%0.33%0%
Klebsiella quasipneumoniae0%0%0.13%0%
Proteus mirabilis0%0%0.5%0%
Providencia stuartii0%2.27%0%0%
Pseudomonas aeruginosa0%0%0.24%0%
Pseudomonas chlororaphis0%0%1.61%0%
Pseudomonas putida0%0%0.53%0%
Salmonella enterica0%0.05%0.17%0.33%
Serratia marcescens0%1.29%0.39%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAD46626.1|+|AAC(6')-IIc [Pseudomonas aeruginosa]
MSANNAAIVLRVMAENDLPMLHAWLNRPHIVEWWGGEDERPTLDEVLEHYSPEVLAKQAVVPYIAMLDDEPIGYAQSYIALGSGDGWWED
ETDPGVRGIDQSLANPSQLNKGLGTKLVRSLVELLFSDPAVTKIQTDPSPSNHRAIRCYEKAGFVQEKNILTPDGPAVYMVQTRQAFESL
RTVQSFKIKGKWS


>gb|AF162771.1|+|62-643|AAC(6')-IIc [Pseudomonas aeruginosa]
ATGTCCGCCAACAATGCCGCAATAGTTCTACGAGTCATGGCCGAGAACGATCTGCCAATGCTCCATGCTTGGCTGAACCGCCCCCACATA
GTCGAGTGGTGGGGCGGCGAGGATGAACGCCCAACTCTTGACGAAGTCTTAGAACACTATTCGCCCGAAGTTCTGGCAAAGCAAGCTGTA
GTGCCTTACATCGCAATGCTAGATGACGAACCCATCGGCTACGCCCAATCCTACATCGCACTTGGAAGTGGCGATGGATGGTGGGAAGAC
GAAACTGATCCAGGGGTCCGCGGGATTGACCAGTCTTTGGCTAATCCATCACAGTTAAACAAGGGGTTGGGTACAAAGCTCGTACGCTCG
CTCGTTGAACTCCTGTTTAGCGACCCGGCCGTAACGAAAATCCAAACCGATCCATCTCCTAGCAACCATCGCGCCATTCGCTGCTACGAG
AAGGCCGGGTTCGTTCAAGAAAAAAACATCCTCACACCTGACGGCCCTGCGGTGTACATGGTCCAAACACGCCAGGCGTTCGAAAGCCTG
CGCACTGTTCAAAGCTTCAAAATCAAGGGGAAGTGGTCATGA