AAC(6')-IIc

Download Sequences

Accession	ARO:3002596
CARD Short Name	AAC(6')-IIc
Definition	AAC(6')-IIc is an aminoglycoside acetyltransferase encoded by plasmids and integrons in E. cloacae.
AMR Gene Family	AAC(6')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas veronii^p, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter youngae^wgs, Cronobacter malonaticus^wgs, Enterobacter asburiae^g+p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^wgs, Klebsiella quasipneumoniae^wgs, Proteus mirabilis^wgs, Providencia stuartii^p, Pseudomonas aeruginosa^wgs, Pseudomonas chlororaphis^wgs, Pseudomonas putida^wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Aeromonas veronii^p, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter youngae^wgs, Comamonas testosteroni^p, Cronobacter malonaticus^wgs, Enterobacter asburiae^g+p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^wgs, Klebsiella quasipneumoniae^wgs, Proteus mirabilis^wgs, Providencia stuartii^p, Pseudomonas aeruginosa^wgs, Pseudomonas chlororaphis^wgs, Pseudomonas putida^wgs, Salmonella enterica^p+wgs+gi, Serratia marcescens^p+wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + antibiotic mixture + AAC(6') [AMR Gene Family]
Parent Term(s)	8 ontology terms \| Show + confers_resistance_to_antibiotic dibekacin [Antibiotic] + confers_resistance_to_antibiotic sisomicin [Antibiotic] + confers_resistance_to_antibiotic netilmicin [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic] + confers_resistance_to_antibiotic 5-episisomicin [Antibiotic] + confers_resistance_to_antibiotic gentamicin [Antibiotic] + AAC(6')-II
Publications	Galani I, et al. 2005. J Antimicrob Chemother 55(5): 634-638. Characterization of a new integron containing bla(VIM-1) and aac(6')-IIc in an Enterobacter cloacae clinical isolate from Greece. (PMID 15761066)

Resistomes

Prevalence of AAC(6')-IIc among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Acinetobacter baumannii	0%	0%	0%	0%	0%
Aeromonas veronii	0%	1.54%	0%	0%	0%
Aeromonas veronii	0%	1.54%	0%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter freundii	0%	0%	2.32%	0%	0%
Citrobacter freundii	0%	0%	2.32%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	1.47%	0.9%	0%	0%
Citrobacter portucalensis	0%	1.47%	0.9%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Comamonas testosteroni	0%	0%	0%	0%	0%
Comamonas testosteroni	0%	50%	0%	0%	0%
Cronobacter malonaticus	0%	0%	1.82%	0%	0%
Cronobacter malonaticus	0%	0%	1.82%	0%	0%
Enterobacter asburiae	6.45%	1.38%	7.51%	0%	0%
Enterobacter asburiae	6.45%	1.38%	7.51%	0%	0%
Enterobacter chengduensis	0%	0%	16%	0%	0%
Enterobacter chengduensis	0%	0%	16%	0%	0%
Enterobacter cloacae	0%	1.12%	7.03%	0%	0%
Enterobacter cloacae	0%	1.12%	7.67%	0%	0%
Enterobacter hormaechei	0.72%	5.15%	15.32%	0%	0%
Enterobacter hormaechei	0.72%	5.08%	15.24%	0%	0%
Enterobacter kobei	0%	0%	6.11%	0%	0%
Enterobacter kobei	0%	0%	6.11%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Escherichia coli	0%	0%	0.07%	0%	0%
Escherichia coli	0%	0%	0.07%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella michiganensis	0%	0.57%	0.27%	0%	0%
Klebsiella michiganensis	0%	0.57%	0.27%	0%	0%
Klebsiella oxytoca	0%	0%	0.84%	0%	0%
Klebsiella oxytoca	0%	0%	1.26%	0%	0%
Klebsiella pneumoniae	0%	0%	0.35%	0%	0%
Klebsiella pneumoniae	0%	0%	0.36%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Proteus mirabilis	0%	0%	0.66%	0%	0%
Proteus mirabilis	0%	0%	0.66%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.24%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.3%	0%	0%
Pseudomonas chlororaphis	0%	0%	1.61%	0%	0%
Pseudomonas chlororaphis	0%	0%	1.61%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%	0%
Salmonella enterica	0%	0.05%	0.17%	0.33%	0%
Salmonella enterica	0%	0.05%	0.17%	0%	0%
Serratia marcescens	0%	1.29%	0.26%	0%	0%
Serratia marcescens	0%	1.29%	0.39%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275

Protein
DNA

>gb|AAD46626.1|+|AAC(6')-IIc [Pseudomonas aeruginosa]
MSANNAAIVLRVMAENDLPMLHAWLNRPHIVEWWGGEDERPTLDEVLEHYSPEVLAKQAVVPYIAMLDDEPIGYAQSYIALGSGDGWWED
ETDPGVRGIDQSLANPSQLNKGLGTKLVRSLVELLFSDPAVTKIQTDPSPSNHRAIRCYEKAGFVQEKNILTPDGPAVYMVQTRQAFESL
RTVQSFKIKGKWS

>gb|AF162771.1|+|62-643|AAC(6')-IIc [Pseudomonas aeruginosa]
ATGTCCGCCAACAATGCCGCAATAGTTCTACGAGTCATGGCCGAGAACGATCTGCCAATGCTCCATGCTTGGCTGAACCGCCCCCACATA
GTCGAGTGGTGGGGCGGCGAGGATGAACGCCCAACTCTTGACGAAGTCTTAGAACACTATTCGCCCGAAGTTCTGGCAAAGCAAGCTGTA
GTGCCTTACATCGCAATGCTAGATGACGAACCCATCGGCTACGCCCAATCCTACATCGCACTTGGAAGTGGCGATGGATGGTGGGAAGAC
GAAACTGATCCAGGGGTCCGCGGGATTGACCAGTCTTTGGCTAATCCATCACAGTTAAACAAGGGGTTGGGTACAAAGCTCGTACGCTCG
CTCGTTGAACTCCTGTTTAGCGACCCGGCCGTAACGAAAATCCAAACCGATCCATCTCCTAGCAACCATCGCGCCATTCGCTGCTACGAG
AAGGCCGGGTTCGTTCAAGAAAAAAACATCCTCACACCTGACGGCCCTGCGGTGTACATGGTCCAAACACGCCAGGCGTTCGAAAGCCTG
CGCACTGTTCAAAGCTTCAAAATCAAGGGGAAGTGGTCATGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

AAC(6')-IIc

Prevalence: protein homolog model (view sequences)

Graph