AAC(6')-IIc

Accession ARO:3002596
DefinitionAAC(6')-IIc is an aminoglycoside acetyltransferase encoded by plasmids and integrons in E. cloacae
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter freundiip+wgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaewgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter freundiip+wgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaewgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs
Classification19 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ AAC(6') [AMR Gene Family]
Publications

Galani I, et al. 2005. J Antimicrob Chemother 55(5): 634-638. Characterization of a new integron containing bla(VIM-1) and aac(6')-IIc in an Enterobacter cloacae clinical isolate from Greece. (PMID 15761066)

Resistomes

Prevalence of AAC(6')-IIc among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.09%
Citrobacter freundii0%1.89%1.91%
Enterobacter asburiae0%18.75%13.1%
Enterobacter cloacae0%2.3%10.55%
Enterobacter hormaechei0%5.49%10.27%
Enterobacter kobei0%0%10.14%
Escherichia coli0%0.01%0.12%
Klebsiella aerogenes0%2%0.94%
Klebsiella oxytoca0%0%0.39%
Klebsiella pneumoniae0%0%0.57%
Proteus mirabilis0%0%0.56%
Providencia stuartii0%5.88%0%
Pseudomonas aeruginosa0%0%0.2%
Salmonella enterica0.2%0.27%0.21%
Serratia marcescens0%1.14%0.36%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 275


>gb|AAD46626.1|+|AAC(6')-IIc [Pseudomonas aeruginosa]
MSANNAAIVLRVMAENDLPMLHAWLNRPHIVEWWGGEDERPTLDEVLEHYSPEVLAKQAVVPYIAMLDDEPIGYAQSYIALGSGDGWWED
ETDPGVRGIDQSLANPSQLNKGLGTKLVRSLVELLFSDPAVTKIQTDPSPSNHRAIRCYEKAGFVQEKNILTPDGPAVYMVQTRQAFESL
RTVQSFKIKGKWS


>gb|AF162771|+|62-643|AAC(6')-IIc [Pseudomonas aeruginosa]
ATGTCCGCCAACAATGCCGCAATAGTTCTACGAGTCATGGCCGAGAACGATCTGCCAATGCTCCATGCTTGGCTGAACCGCCCCCACATA
GTCGAGTGGTGGGGCGGCGAGGATGAACGCCCAACTCTTGACGAAGTCTTAGAACACTATTCGCCCGAAGTTCTGGCAAAGCAAGCTGTA
GTGCCTTACATCGCAATGCTAGATGACGAACCCATCGGCTACGCCCAATCCTACATCGCACTTGGAAGTGGCGATGGATGGTGGGAAGAC
GAAACTGATCCAGGGGTCCGCGGGATTGACCAGTCTTTGGCTAATCCATCACAGTTAAACAAGGGGTTGGGTACAAAGCTCGTACGCTCG
CTCGTTGAACTCCTGTTTAGCGACCCGGCCGTAACGAAAATCCAAACCGATCCATCTCCTAGCAACCATCGCGCCATTCGCTGCTACGAG
AAGGCCGGGTTCGTTCAAGAAAAAAACATCCTCACACCTGACGGCCCTGCGGTGTACATGGTCCAAACACGCCAGGCGTTCGAAAGCCTG
CGCACTGTTCAAAGCTTCAAAATCAAGGGGAAGTGGTCATGA