QnrA1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002707
CARD Short NameQnrA1
DefinitionQnrA1 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (21), Enterobacter cloacae (8), Klebsiella pneumoniae (6), Salmonella (3), Citrobacter freundii (3), Enterobacteriaceae (3), Escherichia coli J53 (3), Klebsiella oxytoca (2)
GAZChina (3)
FOODONchicken (2)
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesCitrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Edwardsiella tardawgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisp+wgs, Proteus vulgarisp+wgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescensp+wgs, Shewanella putrefaciensp, Vibrio alginolyticuswgs
Resistomes with Sequence VariantsCitrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Edwardsiella tardawgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisp+wgs, Proteus vulgarisp+wgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescensp+wgs, Shewanella putrefaciensp, Vibrio alginolyticuswgs
Publications

Tran JH and Jacoby GA. 2002. Proc Natl Acad Sci U S A 99(8): 5638-5642. Mechanism of plasmid-mediated quinolone resistance. (PMID 11943863)

Resistomes

Prevalence of QnrA1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0%1.23%14.12%0%0%
Citrobacter portucalensis0%0%9.01%0%0%
Citrobacter werkmanii0%0%10.26%0%0%
Edwardsiella tarda0%0%6.67%0%0%
Enterobacter asburiae0%0.55%9.49%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%3.91%14.7%0%0%
Enterobacter hormaechei0.36%2.19%10.62%0%0%
Enterobacter kobei0%1.38%9.61%0%0%
Enterobacter roggenkampii0%0.97%10.79%0%0%
Escherichia coli0%0.04%0.24%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%0.57%0.8%0%0%
Klebsiella oxytoca0%0.68%0.42%0%0%
Klebsiella pneumoniae0%0.13%0.47%0%0%
Klebsiella quasipneumoniae0%0.85%1.05%0%0%
Proteus mirabilis0%2.5%3.3%0%0%
Proteus vulgaris0%11.11%5.56%0%0%
Providencia rettgeri0%2.7%3.18%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa0%0%0.06%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0%0%0.04%0%0%
Serratia marcescens0%0.65%2.36%0%0%
Shewanella putrefaciens0%20%0%0%0%
Vibrio alginolyticus0%0%2.38%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABI50486.1|+|QnrA1 [Klebsiella pneumoniae]
MDIIDKVFQQEDFSRQDLSDSRFRRCRFYQCDFSHCQLQDASFEDCSFIESGAVEGCHFSYADLRDASFKACRLSLANFSGANCFGIEFR
ECDLKGANFSRARFYNQVSHKMYFCSAYISGCNLAYTNLSGQCLEKCELFENNWSNANLSGASLMGSDLSRGTFSRDCWQQVNLRGCDLT
FADLDGLDPRRVNLEGVKICAWQQEQLLEPLGVIVLPD


>gb|DQ831141.1|+|8922-9578|QnrA1 [Klebsiella pneumoniae]
ATGGATATTATTGATAAAGTTTTTCAGCAAGAGGATTTCTCACGCCAGGATTTGAGTGACAGCCGTTTTCGCCGCTGCCGCTTTTATCAG
TGTGACTTCAGCCACTGTCAGCTGCAGGATGCCAGTTTCGAGGATTGCAGTTTCATTGAAAGCGGCGCCGTTGAAGGGTGTCACTTCAGC
TATGCCGATCTGCGCGATGCCAGTTTCAAGGCCTGCCGTCTGTCTTTGGCCAACTTCAGCGGTGCCAACTGCTTTGGCATAGAGTTCAGG
GAGTGCGATCTCAAGGGCGCCAACTTTTCCCGGGCCCGCTTCTACAATCAAGTCAGCCATAAGATGTACTTCTGCTCGGCTTATATCTCA
GGTTGCAACCTGGCCTATACCAACTTGAGTGGCCAATGCCTGGAAAAATGCGAGCTGTTTGAAAACAACTGGAGCAATGCCAATCTCAGC
GGCGCTTCCTTGATGGGCTCAGATCTCAGCCGCGGCACCTTCTCCCGCGACTGTTGGCAACAGGTCAATCTGCGGGGCTGTGACCTAACC
TTTGCCGATCTGGATGGGCTCGACCCCAGACGGGTCAACCTCGAAGGAGTCAAGATCTGTGCCTGGCAACAGGAGCAACTGCTGGAACCC
TTGGGAGTAATAGTGCTGCCGGATTAG

Curator Acknowledgements
Curator Description Most Recent Edit