QnrB1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002714
CARD Short NameQnrB1
DefinitionQnrB1 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (13), Klebsiella pneumoniae (8), Enterobacter cloacae (7), Citrobacter freundii (2), Enterobacteriaceae (2)
GAZIran (2)
FOODON
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesCitrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisg, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+wgs+gi, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Serratia marcescenswgs
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisg, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+wgs+gi, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Serratia marcescenswgs
Publications

Jacoby GA, et al. 2006. Antimicrob Agents Chemother 50(4): 1178-1182. qnrB, another plasmid-mediated gene for quinolone resistance. (PMID 16569827)

Resistomes

Prevalence of QnrB1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0%0%1.35%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis3.7%0%0%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Enterobacter asburiae0%0%5.53%0%0%
Enterobacter chengduensis0%0%8%0%0%
Enterobacter cloacae1.79%0%6.07%10%0%
Enterobacter hormaechei1.08%0.26%7.73%0%0%
Enterobacter kobei0%0%1.75%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0%0.03%0.12%0%0%
Klebsiella aerogenes0%1.09%1.98%0%0%
Klebsiella michiganensis0%2.29%7.71%0%0%
Klebsiella oxytoca0%1.37%2.1%0%0%
Klebsiella pneumoniae0.89%2.34%13.52%0%0%
Klebsiella quasipneumoniae0%0.85%11.18%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0%0%0.17%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Raoultella planticola0%0%2.56%0%0%
Serratia marcescens0%0%1.97%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABC86904.2|+|QnrB1 [Klebsiella pneumoniae]
MALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCR
AQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSE
LGDLDIRGVDLQGVKLDNYQASLLMERLGIAVIG


>gb|DQ351241.1|+|37-681|QnrB1 [Klebsiella pneumoniae]
ATGGCTCTGGCACTCGTTGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAGAAAATTGAAAATAGTACATTTTTTAACTGTGATTTT
TCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGTCAGTTCTATGATCGTGAAAGCCAGAAAGGGTGCAATTTTAGTCGTGCGATG
CTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAATTCCAGTGCGCTGGGCATTGAAATTCGCCACTGCCGC
GCACAAGGCGCAGATTTCCGCGGCGCAAGCTTTATGAATATGATCACCACGCGCACCTGGTTTTGTAGCGCATATATCACGAATACCAAT
CTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTGTGGGAAAACCGTTGGATAGGTGCCCAGGTACTGGGCGCGACG
TTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCAGCAAACTTCACACATTGCGATCTGACCAATTCGGAG
TTGGGTGACTTAGATATTCGGGGCGTTGATTTACAAGGCGTTAAGTTGGACAACTACCAGGCATCGTTGCTCATGGAGCGACTTGGCATC
GCGGTGATTGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit