QnrB4

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002718
CARD Short NameQnrB4
DefinitionQnrB4 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (10), Escherichia coli (9), Enterobacter cloacae (2), Citrobacter freundii (2), Klebsiella (2), Enterobacter (2)
GAZ[Former] State of Korea (2), Iran (2)
FOODON
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas veroniip, Citrobacter amalonaticusp, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+gi, Proteus mirabilisg, Providencia rettgeriwgs, Providencia stuartiip, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneip+gi
Resistomes with Sequence VariantsAeromonas veroniip, Citrobacter amalonaticusp, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+gi, Proteus mirabilisg, Providencia rettgeriwgs, Providencia stuartiip, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneip+gi
Publications

Robicsek A, et al. 2006. Antimicrob Agents Chemother 50(8): 2872-2874. qnr prevalence in ceftazidime-resistant Enterobacteriaceae isolates from the United States. (PMID 16870791)

Resistomes

Prevalence of QnrB4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas veronii0%1.54%0%0%0%
Citrobacter amalonaticus0%8.33%0%0%0%
Citrobacter freundii0%1.85%4.26%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%1.47%0%0%0%
Citrobacter youngae0%0%12.5%0%0%
Enterobacter asburiae0%0.55%0.79%0%0%
Enterobacter chengduensis0%0%16%0%0%
Enterobacter cloacae0%0%3.51%0%0%
Enterobacter hormaechei0%1.03%4.1%0%0%
Enterobacter kobei0%0.69%2.18%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0.05%0.04%0.37%0%0%
Klebsiella aerogenes0%1.09%0.85%0%0%
Klebsiella michiganensis0%1.14%1.33%0%0%
Klebsiella oxytoca2.56%0%1.26%0%0%
Klebsiella pneumoniae0.59%1.14%3.44%0%0%
Klebsiella quasipneumoniae0%1.48%7.76%0%0%
Leclercia adecarboxylata7.14%0%0%50%0%
Proteus mirabilis0.92%0%0%0%0%
Providencia rettgeri0%0%0.64%0%0%
Providencia stuartii0%2.27%0%0%0%
Raoultella planticola0%2.33%2.56%0%0%
Salmonella enterica0.13%0.71%0.58%0%0%
Serratia marcescens0%0%0.13%0%0%
Shigella boydii0%0%1.11%0%0%
Shigella flexneri0%0%0.16%0%0%
Shigella sonnei0%0.97%0%4.76%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABC17630.3|+|QnrB4 [Escherichia coli]
MTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRANLKDAIFKSCDLSMADFRNINALGIEIRHCR
AQGSDFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSSFDWRAANVTHCDLTNSE
LGDLDIRGVDLQGVKLDSYQASLLLERLGIAVMG


>gb|DQ303921.2|+|4-648|QnrB4 [Escherichia coli]
ATGACTCTGGCGTTAGTTGGCGAAAAAATTGACAGAAACAGGTTCACCGGTGAAAAAGTTGAAAATAGCACATTTTTCAACTGTGATTTT
TCGGGTGCCGACCTTAGCGGCACTGAATTTATTGGCTGCCAGTTTTATGATCGAGAAAGTCAGAAAGGATGTAATTTTAGTCGCGCTAAC
CTGAAAGATGCCATTTTCAAAAGTTGTGATCTCTCCATGGCTGATTTCAGGAATATCAATGCGCTGGGAATCGAAATTCGCCACTGCCGG
GCACAAGGGTCAGATTTTCGCGGCGCAAGTTTTATGAATATGATCACCACCCGCACCTGGTTTTGTAGCGCCTATATCACCAATACCAAC
TTAAGCTACGCCAACTTTTCAAAAGTCGTACTGGAAAAGTGCGAGCTGTGGGAAAACCGCTGGATGGGTACTCAGGTGCTGGGCGCAACG
TTCAGTGGATCAGACCTCTCTGGCGGCGAGTTTTCATCCTTCGACTGGCGAGCAGCAAACGTTACGCACTGTGATTTGACCAATTCGGAA
CTGGGCGATTTAGATATCCGCGGGGTTGATTTGCAAGGCGTCAAACTGGACAGCTACCAGGCATCGTTGCTCCTGGAACGTCTTGGTATC
GCTGTCATGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit