QnrB4

Download Sequences

Accession	ARO:3002718
CARD Short Name	QnrB4
Definition	QnrB4 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.
AMR Gene Family	quinolone resistance protein (qnr)
Drug Class	fluoroquinolone antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Perfect Matches	Aeromonas veronii^p, Citrobacter amalonaticus^p, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p, Citrobacter youngae^wgs, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+gi, Proteus mirabilis^g, Providencia rettgeri^wgs, Providencia stuartii^p, Raoultella planticola^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella flexneri^wgs, Shigella sonnei^p+gi
Resistomes with Sequence Variants	Aeromonas veronii^p, Citrobacter amalonaticus^p, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p, Citrobacter youngae^wgs, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+gi, Proteus mirabilis^g, Providencia rettgeri^wgs, Providencia stuartii^p, Raoultella planticola^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella flexneri^wgs, Shigella sonnei^p+gi
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic target protection [Resistance Mechanism] + fluoroquinolone antibiotic [Drug Class] + sparfloxacin [Antibiotic] + norfloxacin [Antibiotic] + nalidixic acid [Antibiotic] + gatifloxacin [Antibiotic] + antibiotic target protection protein + moxifloxacin [Antibiotic] + levofloxacin [Antibiotic] + ciprofloxacin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic ciprofloxacin [Antibiotic] + quinolone resistance protein (qnr) [AMR Gene Family]
Publications	Robicsek A, et al. 2006. Antimicrob Agents Chemother 50(8): 2872-2874. qnr prevalence in ceftazidime-resistant Enterobacteriaceae isolates from the United States. (PMID 16870791)

Resistomes

Prevalence of QnrB4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas veronii	0%	1.54%	0%	0%
Aeromonas veronii	0%	1.54%	0%	0%
Citrobacter amalonaticus	0%	8.33%	0%	0%
Citrobacter amalonaticus	0%	8.33%	0%	0%
Citrobacter freundii	0%	1.85%	3.68%	0%
Citrobacter freundii	0%	1.85%	3.68%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%
Citrobacter youngae	0%	0%	12.5%	0%
Citrobacter youngae	0%	0%	12.5%	0%
Enterobacter asburiae	0%	0.55%	0.79%	0%
Enterobacter asburiae	0%	0.55%	0.79%	0%
Enterobacter chengduensis	0%	0%	12%	0%
Enterobacter chengduensis	0%	0%	12%	0%
Enterobacter cloacae	0%	0%	3.51%	0%
Enterobacter cloacae	0%	0%	3.51%	0%
Enterobacter hormaechei	0%	1.03%	1.99%	0%
Enterobacter hormaechei	0%	1.03%	1.99%	0%
Enterobacter kobei	0%	0.69%	2.18%	0%
Enterobacter kobei	0%	0.69%	2.18%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%
Escherichia coli	0.05%	0.04%	0.3%	0%
Escherichia coli	0.05%	0.04%	0.3%	0%
Klebsiella aerogenes	0%	1.09%	0.85%	0%
Klebsiella aerogenes	0%	1.09%	0.85%	0%
Klebsiella michiganensis	0%	1.14%	1.33%	0%
Klebsiella michiganensis	0%	1.14%	1.33%	0%
Klebsiella oxytoca	2.56%	0%	1.26%	0%
Klebsiella oxytoca	2.56%	0%	1.26%	0%
Klebsiella pneumoniae	0.59%	1.14%	2.43%	0%
Klebsiella pneumoniae	0.59%	1.13%	2.41%	0%
Klebsiella quasipneumoniae	0%	1.48%	3.95%	0%
Klebsiella quasipneumoniae	0%	1.48%	3.95%	0%
Leclercia adecarboxylata	7.14%	0%	0%	50%
Leclercia adecarboxylata	7.14%	0%	0%	50%
Proteus mirabilis	0.92%	0%	0%	0%
Proteus mirabilis	0.92%	0%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%
Providencia rettgeri	0%	0%	0.64%	0%
Providencia stuartii	0%	2.27%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%
Raoultella planticola	0%	2.33%	2.56%	0%
Raoultella planticola	0%	2.33%	2.56%	0%
Salmonella enterica	0.13%	0.71%	0.54%	0%
Salmonella enterica	0.13%	0.71%	0.54%	0%
Serratia marcescens	0%	0%	0.13%	0%
Serratia marcescens	0%	0%	0.13%	0%
Shigella boydii	0%	0%	1.11%	0%
Shigella boydii	0%	0%	1.11%	0%
Shigella flexneri	0%	0%	0.16%	0%
Shigella flexneri	0%	0%	0.16%	0%
Shigella sonnei	0%	0.97%	0%	4.76%
Shigella sonnei	0%	0.97%	0%	4.76%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|ABC17630.3|+|QnrB4 [Escherichia coli]
MTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRANLKDAIFKSCDLSMADFRNINALGIEIRHCR
AQGSDFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSSFDWRAANVTHCDLTNSE
LGDLDIRGVDLQGVKLDSYQASLLLERLGIAVMG

>gb|DQ303921.2|+|4-648|QnrB4 [Escherichia coli]
ATGACTCTGGCGTTAGTTGGCGAAAAAATTGACAGAAACAGGTTCACCGGTGAAAAAGTTGAAAATAGCACATTTTTCAACTGTGATTTT
TCGGGTGCCGACCTTAGCGGCACTGAATTTATTGGCTGCCAGTTTTATGATCGAGAAAGTCAGAAAGGATGTAATTTTAGTCGCGCTAAC
CTGAAAGATGCCATTTTCAAAAGTTGTGATCTCTCCATGGCTGATTTCAGGAATATCAATGCGCTGGGAATCGAAATTCGCCACTGCCGG
GCACAAGGGTCAGATTTTCGCGGCGCAAGTTTTATGAATATGATCACCACCCGCACCTGGTTTTGTAGCGCCTATATCACCAATACCAAC
TTAAGCTACGCCAACTTTTCAAAAGTCGTACTGGAAAAGTGCGAGCTGTGGGAAAACCGCTGGATGGGTACTCAGGTGCTGGGCGCAACG
TTCAGTGGATCAGACCTCTCTGGCGGCGAGTTTTCATCCTTCGACTGGCGAGCAGCAAACGTTACGCACTGTGATTTGACCAATTCGGAA
CTGGGCGATTTAGATATCCGCGGGGTTGATTTGCAAGGCGTCAAACTGGACAGCTACCAGGCATCGTTGCTCCTGGAACGTCTTGGTATC
GCTGTCATGGGTTAA

QnrB4

Prevalence: protein homolog model (view sequences)

Graph