QnrB6

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002720
CARD Short NameQnrB6
DefinitionQnrB6 is a plasmid-mediated quinolone resistance protein found in Pantoea agglomerans.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (4), Citrobacter freundii (3)
GAZ
FOODON
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter nosocomialiswgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensisg+p+wgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatap+wgs, Pseudomonas aeruginosawgs, Raoultella planticolap, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella flexnerip+wgs
Resistomes with Sequence VariantsAcinetobacter nosocomialiswgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensisg+p+wgs+gi, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatap+wgs, Pseudomonas aeruginosawgs, Raoultella planticolap, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella flexnerip+wgs
Publications

Sanchez-Cespedes J, et al. 2009. Clin Microbiol Infect 15(12): 1132-1138. Two chromosomally located qnrB variants, qnrB6 and the new qnrB16, in Citrobacter spp. isolates causing bacteraemia. (PMID 19392890)

Resistomes

Prevalence of QnrB6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter nosocomialis0%0%0.57%0%0%
Citrobacter freundii1.64%0.31%3.48%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis11.11%1.47%11.71%100%0%
Enterobacter asburiae0%0.55%2.37%0%0%
Enterobacter cloacae0%0.56%1.92%0%0%
Enterobacter hormaechei0%3.86%6.04%0%0%
Enterobacter kobei0%0%0.44%0%0%
Enterobacter roggenkampii0%0.48%1.08%0%0%
Escherichia coli0%0.05%0.18%0%0%
Escherichia fergusonii0%0%1.09%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella huaxiensis100%0%0%50%0%
Klebsiella michiganensis0%0.57%1.86%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0%0.28%1.67%0%0%
Klebsiella quasipneumoniae0%1.27%2.63%0%0%
Leclercia adecarboxylata0%4.76%4.65%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Raoultella planticola0%2.33%0%0%0%
Salmonella enterica0.13%0.16%0.29%0%0%
Serratia marcescens0%0%0.79%0%0%
Shigella flexneri0%0.4%0.16%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABP87778.1|+|QnrB6 [Pantoea agglomerans]
MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRN
ASALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRA
ANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVIG


>gb|EF520349.1|+|1-681|QnrB6 [Pantoea agglomerans]
ATGACGCCATTACTGTATAAAAAAACAGGTACAAATATGGCTCTGGCACTCGTTGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAG
AAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGTCAGTTCTATGATCGT
GAAAGCCAGAAAGGGTGCAATTTTAGTCGTGCGATGCTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAAT
GCCAGTGCGCTGGGCATTGAAATTCGCCACTGCCGCGCACAAGGCGCAGATTTCCGCGGCGCAAGCTTTATGAATATGATCACCACGCGC
ACCTGGTTTTGTAGCGCATATATCACGAATACCAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTGTGGGAA
AACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCA
GCAAACTTCACACATTGCGATCTGACCAATTCGGAGTTGGGTGACTTAGATATTCGGGGCGTTGATTTACAAGGCGTTAAGCTGGACAAC
TACCAGGCGTCGTTGCTCATGGAGCGGCTTGGCATCGCGGTGATTGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit