QnrB6

Download Sequences

Accession	ARO:3002720
CARD Short Name	QnrB6
Definition	QnrB6 is a plasmid-mediated quinolone resistance protein found in Pantoea agglomerans.
AMR Gene Family	quinolone resistance protein (qnr)
Drug Class	fluoroquinolone antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Perfect Matches	Citrobacter freundii^g+p, Citrobacter portucalensis^g+p, Enterobacter asburiae^p, Enterobacter cloacae^p, Enterobacter hormaechei^p, Escherichia coli^p, Klebsiella huaxiensis^g, Klebsiella michiganensis^p, Klebsiella pneumoniae^p, Klebsiella quasipneumoniae^p, Leclercia adecarboxylata^p, Raoultella planticola^p, Salmonella enterica^g+p, Shigella flexneri^p
Resistomes with Sequence Variants	Citrobacter freundii^g+p, Citrobacter portucalensis^g+p, Enterobacter asburiae^p, Enterobacter cloacae^p, Enterobacter hormaechei^p, Enterobacter roggenkampii^p, Escherichia coli^p, Klebsiella huaxiensis^g, Klebsiella michiganensis^p, Klebsiella pneumoniae^p, Klebsiella quasipneumoniae^p, Leclercia adecarboxylata^p, Raoultella planticola^p, Salmonella enterica^g+p, Shigella flexneri^p
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + fluoroquinolone antibiotic [Drug Class] + determinant of antibiotic resistance + antibiotic target protection [Resistance Mechanism] + nalidixic acid [Antibiotic] + gatifloxacin [Antibiotic] + levofloxacin [Antibiotic] + moxifloxacin [Antibiotic] + norfloxacin [Antibiotic] + ciprofloxacin [Antibiotic] + sparfloxacin [Antibiotic] + antibiotic target protection protein
Parent Term(s)	2 ontology terms \| Show + quinolone resistance protein (qnr) [AMR Gene Family] + confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
Publications	Sanchez-Cespedes J, et al. 2009. Clin Microbiol Infect 15(12): 1132-1138. Two chromosomally located qnrB variants, qnrB6 and the new qnrB16, in Citrobacter spp. isolates causing bacteraemia. (PMID 19392890)

Resistomes

Prevalence of QnrB6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 381 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Citrobacter freundii	1.64%	0.31%	0%	0%
Citrobacter freundii	1.64%	0.31%	0%	0%
Citrobacter portucalensis	11.11%	1.47%	0%	0%
Citrobacter portucalensis	11.11%	1.47%	0%	0%
Enterobacter asburiae	0%	0.55%	0%	0%
Enterobacter asburiae	0%	0.55%	0%	0%
Enterobacter cloacae	0%	0.56%	0%	0%
Enterobacter cloacae	0%	0.56%	0%	0%
Enterobacter hormaechei	0%	3.22%	0%	0%
Enterobacter hormaechei	0%	3.86%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%
Escherichia coli	0%	0.05%	0%	0%
Escherichia coli	0%	0.05%	0%	0%
Klebsiella huaxiensis	100%	0%	0%	0%
Klebsiella huaxiensis	100%	0%	0%	0%
Klebsiella michiganensis	0%	0.57%	0%	0%
Klebsiella michiganensis	0%	0.57%	0%	0%
Klebsiella pneumoniae	0%	0.28%	0%	0%
Klebsiella pneumoniae	0%	0.25%	0%	0%
Klebsiella quasipneumoniae	0%	1.27%	0%	0%
Klebsiella quasipneumoniae	0%	1.27%	0%	0%
Leclercia adecarboxylata	0%	4.76%	0%	0%
Leclercia adecarboxylata	0%	4.76%	0%	0%
Raoultella planticola	0%	2.33%	0%	0%
Raoultella planticola	0%	2.33%	0%	0%
Salmonella enterica	0.13%	0.16%	0%	0%
Salmonella enterica	0.13%	0.16%	0%	0%
Shigella flexneri	0%	0.4%	0%	0%
Shigella flexneri	0%	0.4%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|ABP87778.1|+|QnrB6 [Pantoea agglomerans]
MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRN
ASALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRA
ANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVIG

>gb|EF520349.1|+|1-681|QnrB6 [Pantoea agglomerans]
ATGACGCCATTACTGTATAAAAAAACAGGTACAAATATGGCTCTGGCACTCGTTGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAG
AAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGTCAGTTCTATGATCGT
GAAAGCCAGAAAGGGTGCAATTTTAGTCGTGCGATGCTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAAT
GCCAGTGCGCTGGGCATTGAAATTCGCCACTGCCGCGCACAAGGCGCAGATTTCCGCGGCGCAAGCTTTATGAATATGATCACCACGCGC
ACCTGGTTTTGTAGCGCATATATCACGAATACCAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTGTGGGAA
AACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCA
GCAAACTTCACACATTGCGATCTGACCAATTCGGAGTTGGGTGACTTAGATATTCGGGGCGTTGATTTACAAGGCGTTAAGCTGGACAAC
TACCAGGCGTCGTTGCTCATGGAGCGGCTTGGCATCGCGGTGATTGGTTAG

QnrB6

Prevalence: protein homolog model (view sequences)

Graph