QnrB10

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002724
CARD Short NameQnrB10
DefinitionQnrB10 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (2)
GAZ
FOODON
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesEnterobacter asburiaep, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella oxytocawgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas hydrophilap, Bifidobacterium bifidumwgs, Burkholderia multivoransp, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensisg+wgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Helicobacter pyloriwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Proteus mirabiliswgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Serratia marcescenswgs, Shigella flexneriwgs, Shigella sonneiwgs, Staphylococcus aureuswgs
Publications

Quiroga MP, et al. 2007. Antimicrob Agents Chemother 51(12): 4466-4470. Complex class 1 integrons with diverse variable regions, including aac(6')-Ib-cr, and a novel allele, qnrB10, associated with ISCR1 in clinical enterobacterial isolates from Argentina. (PMID 17938184)

Resistomes

Prevalence of QnrB10 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.01%0%0%
Aeromonas hydrophila0%1.3%0%0%0%
Bifidobacterium bifidum0%0%0.5%0%0%
Burkholderia multivorans0%2.94%0%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii2.46%0.31%1.55%0%0%
Citrobacter portucalensis3.7%0%1.8%0%0%
Enterobacter asburiae0%0.28%0.79%0%0%
Enterobacter chengduensis0%0%8%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0.19%2.03%0%0%
Enterobacter kobei0%0.69%2.18%0%0%
Enterobacter roggenkampii2.33%0.48%0.72%0%0%
Escherichia coli0.07%0.16%0.76%0%0.04%
Escherichia fergusonii0%0%1.09%0%0%
Helicobacter pylori0%0%0.11%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella oxytoca0%0%1.26%0%0%
Klebsiella pneumoniae0%0.14%0.56%0%0%
Klebsiella quasipneumoniae0%0.21%1.18%0%0%
Leclercia adecarboxylata0%0%2.33%0%0%
Proteus mirabilis0%0%0.17%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Salmonella enterica0%0.66%1.02%0%0%
Serratia marcescens0%0%1.31%0%0%
Shigella flexneri0%0%0.16%0%0%
Shigella sonnei0%0%0.37%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABG56269.1|+|QnrB10 [Citrobacter freundii]
MLSLLYKNTGIDMTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRN
VSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSTFDWRA
ANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVIG


>gb|DQ631414.1|+|1-681|QnrB10 [Citrobacter freundii]
ATGTTGTCATTACTGTATAAAAACACAGGCATAGATATGACTCTGGCATTAGTTGGCGAAAAAATTGACAGAAACCGCTTCACCGGTGAG
AAAGTTGAAAATAGTACATTTTTTAACTGCGATTTTTCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGCCAGTTCTATGATCGC
GAAAGTCAGAAAGGGTGCAATTTTAGTCGCGCAATGCTGAAAGATGCCATTTTCAAAAGCTGTGATTTATCAATGGCAGATTTCCGCAAC
GTCAGCGCATTGGGCATTGAAATTCGCCACTGTCGCGCACAAGGCGCAGATTTTCGCGGTGCAAGCTTTATGAATATGATCACCACGCGC
ACCTGGTTTTGCAGCGCATATATCACTAATACCAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTATGGGAA
AACCGCTGGATGGGGACTCAGGTACTGGGTGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCC
GCAAACTTCACACATTGCGATCTGACCAATTCGGAGTTAGGTGACTTAGATATTCGGGGTGTTGATTTACAAGGCGTTAAGTTAGACAAC
TACCAGGCATCGTTGCTCATGGAGCGACTTGGCATCGCTGTGATTGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit