QnrB17

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002732
CARD Short NameQnrB17
DefinitionQnrB17 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesCitrobacter portucalensisg+wgs, Enterobacter hormaecheip
Resistomes with Sequence VariantsCitrobacter freundiig+wgs, Citrobacter portucalensisg+wgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Salmonella entericawgs, Serratia marcescenswgs
Publications

Guillard T, et al. 2012. J Antimicrob Chemother 67(11): 2635-2639. High-resolution melting analysis for rapid characterization of qnr alleles in clinical isolates and detection of two novel alleles, qnrB25 and qnrB42. (PMID 22850691)

Resistomes

Prevalence of QnrB17 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0.82%0%0.58%0%0%
Citrobacter portucalensis11.11%0%17.12%0%0%
Enterobacter asburiae0%0%1.19%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%0%1.92%0%0%
Enterobacter hormaechei0%0.64%2.68%0%0%
Enterobacter kobei0%0%1.75%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0%0.01%0.04%0%0%
Klebsiella michiganensis0%0%0.53%0%0%
Klebsiella pneumoniae0%0.25%1.61%0%0%
Klebsiella quasipneumoniae0%0%0.39%0%0%
Salmonella enterica0%0%0.01%0%0%
Serratia marcescens0%0%0.66%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAP45902.1|+|QnrB17 [Citrobacter freundii]
MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRN
SSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRA
ANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVIG


>gb|AM919398.1|+|1-681|QnrB17 [Citrobacter freundii]
ATGACGCCATTACTGTATAAAAAAACAGGTACAAATATGGCTCTGGCACTCGTTGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAG
AAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGTCAGTTCTATGATCGT
GAAAGCCAGAAAGGGTGCAATTTTAGTCGTGCGATGCTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAAT
TCCAGTGCGCTGGGCATTGAAATTCGCCACTGCCGCGCACAAGGCGCAGATTTCCGCGGCGCAAGCTTTATGAATATGATCACCACGCGC
ACCTGGTTTTGTAGCGCATATATCACGAATACCAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTGTGGGAA
AACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCA
GCGAACTTCACACATTGCGATCTGACCAATTCGGAGTTGGGTGACTTAGATATTCGGGGCGTTGATTTACAAGGCGTTAAGCTGGACAAC
TACCAGGCGTCGTTGCTCATGGAGCGGCTTGGCATCGCGGTGATTGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit