QnrB19

Download Sequences

Accession	ARO:3002734
CARD Short Name	QnrB19
Definition	QnrB19 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.
AMR Gene Family	quinolone resistance protein (qnr)
Drug Class	fluoroquinolone antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Perfect Matches	Aeromonas hydrophila^wgs, Enterobacter cloacae^p, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs+gi, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs
Resistomes with Sequence Variants	Aeromonas hydrophila^wgs, Citrobacter freundii^wgs, Enterobacter cloacae^p, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs+gi, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic target protection [Resistance Mechanism] + fluoroquinolone antibiotic [Drug Class] + sparfloxacin [Antibiotic] + norfloxacin [Antibiotic] + nalidixic acid [Antibiotic] + gatifloxacin [Antibiotic] + antibiotic target protection protein + moxifloxacin [Antibiotic] + levofloxacin [Antibiotic] + ciprofloxacin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic ciprofloxacin [Antibiotic] + quinolone resistance protein (qnr) [AMR Gene Family]
Publications	Cattoir V, et al. 2008. Antimicrob Agents Chemother 52(8): 2929-2932. ISEcp1-mediated transposition of qnrB-like gene in Escherichia coli. (PMID 18519717)

Resistomes

Prevalence of QnrB19 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Aeromonas hydrophila	0%	0%	0.81%	0%	0%
Aeromonas hydrophila	0%	0%	0.81%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Enterobacter cloacae	0%	1.12%	0%	0%	0%
Enterobacter cloacae	0%	1.12%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0.17%	0%	0%
Enterobacter hormaechei	0%	0%	0.17%	0%	0%
Escherichia coli	0%	0.03%	0.23%	0.13%	0%
Escherichia coli	0%	0.04%	0.24%	0.13%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella pneumoniae	0%	0.05%	0.16%	0%	0%
Klebsiella pneumoniae	0%	0.05%	0.16%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0.11%	0.37%	0%	0%
Salmonella enterica	0%	0.11%	0.36%	0%	0%
Serratia marcescens	0%	0%	0.52%	0%	0%
Serratia marcescens	0%	0%	0.52%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|AGK90303.1|+|QnrB19 [Escherichia coli]
MTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNVSALGIEIRHCR
AQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSE
LGDLDIRGVDLQGVKLDSYQASLLMERLGIAVIG

>gb|JX298080.1|+|434-1078|QnrB19 [Escherichia coli]
ATGACTCTGGCATTAGTTGGCGAAAAAATTGACAGAAATCGCTTCACCGGTGAGAAAGTTGAAAATAGTACATTTTTTAACTGCGATTTT
TCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGCCAGTTCTATGATCGCGAAAGTCAGAAAGGGTGCAATTTTAGTCGCGCAATG
CTGAAAGATGCCATTTTCAAAAGCTGTGATTTATCAATGGCAGATTTCCGCAACGTCAGTGCCTTGGGCATTGAAATTCGCCACTGCCGC
GCACAAGGCGCAGATTTCCGCGGTGCAAGCTTTATGAATATGATCACCACGCGCACCTGGTTTTGCAGCGCATATATCACTAATACTAAT
CTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTGTGGGAAAACCGCTGGATGGGGACTCAGGTACTGGGTGCGACG
TTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCAGCAAACTTCACACATTGCGATCTGACCAATTCGGAG
TTAGGTGACTTAGATATTCGGGGTGTTGATTTACAAGGCGTTAAGTTAGACAGCTACCAGGCATCGTTGCTCATGGAGCGGCTTGGCATC
GCTGTGATTGGTTAG

Curator Acknowledgements

Curator	Description	Most Recent Edit

QnrB19

Prevalence: protein homolog model (view sequences)

Graph