QnrB20

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002735
CARD Short NameQnrB20
DefinitionQnrB20 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Sequence VariantsCitrobacter amalonaticusp+wgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiiwgs, Pseudomonas aeruginosag+wgs, Raoultella planticolap+wgs, Salmonella entericawgs, Serratia marcescensp+wgs
Publications

Teo JW, et al. 2009. Int J Antimicrob Agents 33(2): 177-180. Detection and genetic characterisation of qnrB in hospital isolates of Klebsiella pneumoniae in Singapore. (PMID 18993034)

Resistomes

Prevalence of QnrB20 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus0%8.33%3.64%0%0%
Citrobacter freundii0%2.77%3.68%0%0%
Citrobacter koseri0%15%3.6%0%0%
Citrobacter portucalensis0%13.24%14.41%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0.28%1.58%0%0%
Enterobacter cloacae0%1.12%1.92%0%0%
Enterobacter hormaechei0%1.29%4.49%0%0%
Enterobacter kobei0%0.69%2.18%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0%0.05%0.17%0%0%
Klebsiella aerogenes0%1.09%0%0%0%
Klebsiella michiganensis0%6.86%4.79%0%0%
Klebsiella oxytoca0%2.05%0.42%0%0%
Klebsiella pneumoniae0%0.13%0.35%0%0%
Klebsiella quasipneumoniae0%0.21%0.53%0%0%
Leclercia adecarboxylata0%0%37.21%0%0%
Morganella morganii0%0%1.23%0%0%
Pseudomonas aeruginosa0.15%0%0.01%0%0%
Raoultella planticola0%6.98%12.82%0%0%
Salmonella enterica0%0%0.24%0%0%
Serratia marcescens0%0.65%0.26%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|BAG55487.1|+|QnrB20 [Escherichia coli]
MTPLLYKKTGTNMALALVGEKINRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRN
ASALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRA
ANFTHCDLTNSELGDLDIRRVDLQGVKLDNYQASLLMERLGIAVIG


>gb|AB379831.1|+|1-681|QnrB20 [Escherichia coli]
ATGACGCCATTACTGTATAAAAAAACAGGCACAAATATGGCTCTGGCACTCGTTGGCGAAAAAATTAACAGAAACCGCTTCACCGGTGAG
AAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGTCAGTTCTATGATCGT
GAAAGCCAGAAAGGGTGCAATTTTAGTCGTGCGATGCTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAAT
GCCAGTGCGCTTGGCATTGAAATTCGCCACTGTCGTGCGCAAGGCGCAGATTTTCGCGGCGCAAGTTTTATGAATATGATCACTACTCGC
ACCTGGTTTTGCAGTGCATATATCACTAACACAAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTGTGGGAA
AACCGTTGGATGGGGGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCGACTTTCGACTGGCGAGCA
GCAAACTTCACACATTGCGATCTGACCAATTCGGAGTTGGGTGACTTAGATATTCGGCGCGTTGATTTACAAGGCGTTAAGTTGGACAAC
TACCAGGCATCGTTGCTCATGGAACGTCTTGGCATCGCGGTGATTGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit