QnrB62

Accession ARO:3002775
CARD Short NameQnrB62
DefinitionQnrB62 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Escherichia coliwgs
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ quinolone resistance protein (qnr) [AMR Gene Family]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
Publications

Lee JJ, et al. 2016. Antimicrob Agents Chemother 60(11):6937-6940 Complex Class 1 Integron Carrying qnrB62 and blaVIM-2 in a Citrobacter freundii Clinical Isolate. (PMID 27572415)

Resistomes

Prevalence of QnrB62 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Citrobacter freundii0%0%0.24%0%
Escherichia coli0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AFY16910.1|+|QnrB62 [Citrobacter freundii]
MTPLLYKNTGIDMTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRN
VSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSTFDWRA
ANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAIIG


>gb|JX987101.1|+|1-681|QnrB62 [Citrobacter freundii]
ATGACGCCATTACTGTATAAAAACACAGGCATAGATATGACTCTGGCATTAGTTGGCGAAAAAATTGACAGAAATCGCTTCACCGGTGAG
AAAGTTGAAAATAGTACATTTTTTAACTGCGATTTTTCAGGTGCCGACCTGAGCGGCACTGAATTTATCGGCTGCCAGTTCTATGATCGC
GAAAGTCAAAAAGGATGCAATTTTAGTCGCGCAATGCTGAAAGATGCCATTTTCAAAAGCTGTGATTTATCAATGGCAGATTTCCGCAAC
GTCAGCGCATTGGGCATTGAAATTCGCCACTGCCGCGCACAAGGCGCAGATTTCCGCGGTGCAAGCTTTATGAATATGATCACCACGCGC
ACCTGGTTTTGCAGCGCATATATCACTAATACCAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGTTGGAAAAGTGTGAGCTATGGGAA
AACCGCTGGATGGGGACTCAGGTACTGGGTGCGACGTTTAGTGGTTCAGATCTCTCCGGTGGCGAGTTTTCGACTTTCGACTGGCGAGCA
GCAAACTTCACACATTGCGATCTGACCAATTCGGAGTTAGGTGACTTAGATATTCGGGGTGTTGATTTACAAGGCGTTAAGTTAGACAAC
TACCAGGCATCGTTGCTCATGGAGCGACTTGGCATCGCGATTATTGGCTAG