QnrD1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002788
CARD Short NameQnrD1
DefinitionQnrD1 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEnterobacteriaceae (2)
GAZ
FOODON
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas hydrophilawgs, Alcaligenes faecaliswgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Morganella morganiip+wgs, Proteus columbaewgs, Proteus mirabilisp+wgs, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia heimbachaewgs, Providencia rettgerip+wgs, Providencia stuartiip+wgs, Salmonella entericawgs, Serratia marcescenswgs, Staphylococcus aureuswgs, Streptococcus anginosuswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAeromonas hydrophilawgs, Alcaligenes faecaliswgs, Citrobacter freundiip, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Morganella morganiip+wgs, Proteus columbaewgs, Proteus mirabilisp+wgs, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia heimbachaewgs, Providencia rettgerip+wgs, Providencia stuartiip+wgs, Salmonella entericawgs, Serratia marcescenswgs, Staphylococcus aureuswgs, Streptococcus anginosuswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Publications

Cavaco LM, et al. 2009. Antimicrob Agents Chemother 53(2): 603-608. qnrD, a novel gene conferring transferable quinolone resistance in Salmonella enterica serovar Kentucky and Bovismorbificans strains of human origin. (PMID 19029321)

Resistomes

Prevalence of QnrD1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas hydrophila0%0%1.61%0%0%
Alcaligenes faecalis0%0%2.94%0%0%
Citrobacter freundii0%0.31%0%0%0%
Enterobacter hormaechei0%0%0.17%0%0%
Enterobacter kobei0%0%0.44%0%0%
Escherichia coli0%0%0.04%0%0%
Klebsiella pneumoniae0%0%0.06%0%0%
Morganella morganii0%5%16.56%0%0%
Proteus columbae0%0%100%0%0%
Proteus mirabilis0%10%14.03%0%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris0%11.11%16.67%0%0%
Providencia heimbachae0%0%14.29%0%0%
Providencia rettgeri0%2.7%39.49%0%0%
Providencia stuartii0%11.36%9.09%0%0%
Salmonella enterica0%0%0.17%0%0%
Serratia marcescens0%0%0.13%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Streptococcus anginosus0%0%1.17%0%0%
Vibrio cholerae0%0%0.96%0%0%
Vibrio parahaemolyticus0%0%0.46%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ACG70184.1|+|QnrD1 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
MEKHFINEKFSRDQFTGNRVKNIAFSNCDFSGVDLTDTEFVDCSFYDRNSLEGCDFNRAKLKNASFKSCDLSMSNFKNISALGLEISECL
AQGADFRGANFMNMITTRSWFCSAYITKTNLSYANFSRVILEKCELWENRWNGTVITGAVFRGSDLSCGEFSSFDWSLADFTGCDLTGGA
LGELDARRINLDGVKLDGEQALQLVESLGVIVHR


>gb|FJ228229.1|+|554-1198|QnrD1 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
ATGGAAAAGCACTTTATCAATGAAAAGTTTTCACGAGATCAATTTACGGGGAATAGAGTTAAAAATATTGCCTTTTCAAATTGTGATTTT
TCAGGGGTTGATTTAACTGATACTGAATTTGTTGATTGTAGTTTTTACGACAGGAATAGCTTGGAAGGGTGTGATTTTAATAGAGCCAAA
CTAAAAAACGCTAGCTTTAAAAGCTGCGATTTATCAATGAGTAATTTTAAAAACATTAGCGCCTTAGGTCTTGAAATTAGTGAGTGTTTA
GCTCAAGGAGCTGATTTTCGAGGGGCTAATTTTATGAATATGATAACTACAAGGTCATGGTTTTGTAGTGCTTATATAACCAAGACAAAT
CTTAGTTACGCTAATTTTTCTAGAGTCATATTAGAAAAGTGCGAACTGTGGGAAAATCGCTGGAATGGCACTGTGATAACTGGCGCCGTG
TTTCGTGGCTCCGATCTTTCTTGTGGGGAGTTTTCATCGTTTGATTGGTCTTTGGCTGATTTTACTGGTTGTGATTTAACGGGTGGGGCG
CTTGGCGAGCTTGATGCAAGGCGAATTAATTTAGATGGAGTGAAGTTGGATGGAGAGCAGGCGCTTCAGCTTGTTGAGAGTTTAGGTGTT
ATTGTTCACCGATAA

Curator Acknowledgements
Curator Description Most Recent Edit