QnrD1

Download Sequences

Accession	ARO:3002788
CARD Short Name	QnrD1
Definition	QnrD1 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.
AMR Gene Family	quinolone resistance protein (qnr)
Drug Class	fluoroquinolone antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Perfect Matches	Alcaligenes faecalis^wgs, Enterobacter hormaechei^wgs, Escherichia coli^wgs, Klebsiella pneumoniae^wgs, Morganella morganii^p+wgs, Proteus columbae^wgs, Proteus mirabilis^p+wgs, Proteus penneri^wgs, Proteus vulgaris^p+wgs, Providencia heimbachae^wgs, Providencia rettgeri^p+wgs, Providencia stuartii^p+wgs, Salmonella enterica^wgs, Serratia marcescens^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Alcaligenes faecalis^wgs, Citrobacter freundii^p, Cronobacter sakazakii^wgs, Delftia tsuruhatensis^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Escherichia coli^wgs, Klebsiella pneumoniae^wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^p+wgs, Mycobacterium tuberculosis^wgs, Proteus columbae^wgs, Proteus mirabilis^p+wgs, Proteus penneri^wgs, Proteus vulgaris^p+wgs, Providencia heimbachae^wgs, Providencia rettgeri^p+wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs, Staphylococcus simulans^wgs, Stenotrophomonas maltophilia^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + fluoroquinolone antibiotic [Drug Class] + antibiotic target protection [Resistance Mechanism] + determinant of antibiotic resistance + norfloxacin [Antibiotic] + antibiotic target protection protein + moxifloxacin [Antibiotic] + levofloxacin [Antibiotic] + gatifloxacin [Antibiotic] + nalidixic acid [Antibiotic] + sparfloxacin [Antibiotic] + ciprofloxacin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + quinolone resistance protein (qnr) [AMR Gene Family] + confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
Publications	Cavaco LM, et al. 2009. Antimicrob Agents Chemother 53(2): 603-608. qnrD, a novel gene conferring transferable quinolone resistance in Salmonella enterica serovar Kentucky and Bovismorbificans strains of human origin. (PMID 19029321)

Resistomes

Prevalence of QnrD1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0%	0%	0%	0%
Acinetobacter baumannii	0%	0%	0.02%	0%
Alcaligenes faecalis	0%	0%	3.85%	0%
Alcaligenes faecalis	0%	0%	3.85%	0%
Citrobacter freundii	0%	0%	0%	0%
Citrobacter freundii	0%	0.32%	0%	0%
Cronobacter sakazakii	0%	0%	0.24%	0%
Cronobacter sakazakii	0%	0%	0%	0%
Delftia tsuruhatensis	0%	0%	14.29%	0%
Delftia tsuruhatensis	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0.14%	0%
Enterobacter hormaechei	0%	0%	0.09%	0%
Enterobacter kobei	0%	0%	0.52%	0%
Enterobacter kobei	0%	0%	0%	0%
Escherichia coli	0%	0%	0.03%	0%
Escherichia coli	0%	0%	0.09%	0%
Klebsiella pneumoniae	0%	0%	0.09%	0%
Klebsiella pneumoniae	0%	0%	0.03%	0%
Klebsiella quasipneumoniae	0%	0%	0.16%	0%
Klebsiella quasipneumoniae	0%	0%	0%	0%
Morganella morganii	0%	5.41%	6.9%	0%
Morganella morganii	0%	8.11%	8.28%	0%
Mycobacterium tuberculosis	0%	0%	0%	0%
Mycobacterium tuberculosis	0%	0%	0.02%	0%
Proteus columbae	0%	0%	100%	0%
Proteus columbae	0%	0%	50%	0%
Proteus mirabilis	0%	7.46%	6.38%	0%
Proteus mirabilis	0%	4.48%	5.59%	0%
Proteus penneri	0%	0%	16.67%	0%
Proteus penneri	0%	0%	16.67%	0%
Proteus vulgaris	0%	12.5%	13.33%	0%
Proteus vulgaris	0%	12.5%	13.33%	0%
Providencia heimbachae	0%	0%	33.33%	0%
Providencia heimbachae	0%	0%	33.33%	0%
Providencia rettgeri	0%	2.78%	33.09%	0%
Providencia rettgeri	0%	2.78%	30.88%	0%
Providencia stuartii	0%	7.14%	2.27%	0%
Providencia stuartii	0%	7.14%	2.27%	0%
Pseudomonas aeruginosa	0%	0%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.02%	0%
Salmonella enterica	0%	0%	0.06%	0%
Salmonella enterica	0%	0%	0.08%	0%
Serratia marcescens	0%	0%	0.28%	0%
Serratia marcescens	0%	0%	0.28%	0%
Staphylococcus simulans	0%	0%	1.67%	0%
Staphylococcus simulans	0%	0%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0.17%	0%
Stenotrophomonas maltophilia	0%	0%	0%	0%
Vibrio cholerae	0%	0%	1.38%	0%
Vibrio cholerae	0%	0%	1.04%	0%
Vibrio parahaemolyticus	0%	0%	1%	0%
Vibrio parahaemolyticus	0%	0%	0.31%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|ACG70184.1|+|QnrD1 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
MEKHFINEKFSRDQFTGNRVKNIAFSNCDFSGVDLTDTEFVDCSFYDRNSLEGCDFNRAKLKNASFKSCDLSMSNFKNISALGLEISECL
AQGADFRGANFMNMITTRSWFCSAYITKTNLSYANFSRVILEKCELWENRWNGTVITGAVFRGSDLSCGEFSSFDWSLADFTGCDLTGGA
LGELDARRINLDGVKLDGEQALQLVESLGVIVHR

>gb|FJ228229.1|+|554-1198|QnrD1 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
ATGGAAAAGCACTTTATCAATGAAAAGTTTTCACGAGATCAATTTACGGGGAATAGAGTTAAAAATATTGCCTTTTCAAATTGTGATTTT
TCAGGGGTTGATTTAACTGATACTGAATTTGTTGATTGTAGTTTTTACGACAGGAATAGCTTGGAAGGGTGTGATTTTAATAGAGCCAAA
CTAAAAAACGCTAGCTTTAAAAGCTGCGATTTATCAATGAGTAATTTTAAAAACATTAGCGCCTTAGGTCTTGAAATTAGTGAGTGTTTA
GCTCAAGGAGCTGATTTTCGAGGGGCTAATTTTATGAATATGATAACTACAAGGTCATGGTTTTGTAGTGCTTATATAACCAAGACAAAT
CTTAGTTACGCTAATTTTTCTAGAGTCATATTAGAAAAGTGCGAACTGTGGGAAAATCGCTGGAATGGCACTGTGATAACTGGCGCCGTG
TTTCGTGGCTCCGATCTTTCTTGTGGGGAGTTTTCATCGTTTGATTGGTCTTTGGCTGATTTTACTGGTTGTGATTTAACGGGTGGGGCG
CTTGGCGAGCTTGATGCAAGGCGAATTAATTTAGATGGAGTGAAGTTGGATGGAGAGCAGGCGCTTCAGCTTGTTGAGAGTTTAGGTGTT
ATTGTTCACCGATAA

QnrD1

Prevalence: protein homolog model (view sequences)

Graph