QnrD2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002789
CARD Short NameQnrD2
DefinitionQnrD2 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesMorganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgeriwgs
Resistomes with Sequence VariantsMorganella morganiiwgs, Proteus mirabiliswgs, Providencia alcalifacienswgs, Providencia rettgeriwgs
Publications

Abgottspon H, et al. 2014. Antimicrob Agents Chemother 58(6): 3560-3563. Quinolone Resistance Mechanisms in Salmonella enterica Serovars Hadar, Kentucky, Virchow, Schwarzengrund, and 4,5,12:i:-, Isolated from Humans in Switzerland, and Identification of a Novel qnrD Variant, qnrD2, in S. Hadar. (PMID 24733466)

Resistomes

Prevalence of QnrD2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0%0%2.15%0%0%
Providencia alcalifaciens0%0%3.45%0%0%
Providencia rettgeri0%0%1.27%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AHY03238.1|+|QnrD2 [Salmonella enterica subsp. enterica serovar Hadar]
MEKHFINEKFSRDQFTGNRVKNIAFSNCDFSGVDLTDTEFVDCSFYDRNSLEGCDFNRAKLKNASFKSCDLSMSNFKNISALGLEISECL
AQGADFRGANFMNMITTRSWFCSAYITKTNLSYANFSRVILEKCELWENRWNGTVITGAVFRGSDLSCGEFSSFDWSLADFTGCDLTGGA
LGELDARRTNLDGVKLDGEQAFQLVESLGVIVHR


>gb|KJ158441.1|+|2733-3377|QnrD2 [Salmonella enterica subsp. enterica serovar Hadar]
ATGGAAAAGCACTTTATCAATGAAAAGTTTTCACGAGATCAATTTACGGGGAATAGAGTTAAAAATATTGCCTTTTCAAATTGTGATTTT
TCAGGGGTTGATTTAACTGATACTGAATTTGTTGATTGTAGTTTTTACGACAGGAATAGCTTGGAAGGGTGTGATTTTAATAGAGCCAAA
CTAAAAAACGCTAGCTTTAAAAGCTGCGATTTATCAATGAGTAATTTTAAAAACATTAGCGCCTTAGGTCTTGAGATTAGTGAGTGTTTA
GCTCAAGGAGCTGATTTTCGAGGGGCTAATTTTATGAATATGATAACTACAAGGTCATGGTTTTGTAGTGCTTATATAACCAAGACAAAT
CTTAGTTACGCTAATTTTTCTAGAGTCATATTAGAAAAGTGCGAACTGTGGGAAAATCGCTGGAATGGCACTGTGATAACTGGCGCCGTG
TTTCGTGGCTCCGATCTTTCTTGTGGGGAGTTTTCATCGTTTGATTGGTCTTTGGCTGATTTTACTGGTTGTGATTTAACGGGTGGGGCG
CTTGGCGAGCTTGATGCAAGACGAACTAATTTAGATGGCGTGAAGTTGGATGGAGAACAGGCGTTTCAGCTTGTTGAGAGTTTAGGTGTT
ATTGTTCACCGATAA

Curator Acknowledgements
Curator Description Most Recent Edit