QnrS1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002790
CARD Short NameQnrS1
DefinitionQnrS1 is a plasmid-mediated quinolone resistance protein found in Shigella flexneri.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (56), Salmonella (21), Klebsiella pneumoniae (12), Enterobacter cloacae (6), Shigella flexneri (5), Salmonella enterica (4), Enterobacteriaceae (4), Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 (3), Shigella (3), Aeromonas (2)
GAZRepublic of China (4), Viet Nam (3), China (3), Brazil (2), Europe (2), Iran (2), Italy (2), South Africa (2), The Netherlands (2), Turkey (2)
FOODONswine (3), Bos taurus (3), poultry drumstick (2), chicken (2)
ENVOfarm (3), park (2), hospital (2)
UBERONanimal hemisphere (2)
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip, Citrobacter youngaep+wgs, Cronobacter malonaticuswgs, Cronobacter sakazakiip, Edwardsiella tardap+wgs, Enterobacter asburiaewgs, Enterobacter chengduensisp+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia albertiip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniig+p+wgs, Escherichia marmotaep, Klebsiella aerogenesg+p+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p+wgs, Morganella morganiip+wgs, Proteus mirabilisg+wgs+gi, Raoultella planticolap+wgs, Salmonella entericag+p+wgs+gi, Serratia liquefaciensp, Serratia marcescensg+p+wgs+gi, Shigella boydiip+wgs, Shigella dysenteriaewgs, Shigella flexnerip+wgs, Shigella sonneip+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip, Citrobacter youngaep+wgs, Cronobacter dublinensiswgs, Cronobacter malonaticuswgs, Cronobacter sakazakiip, Edwardsiella tardap+wgs, Enterobacter asburiaewgs, Enterobacter chengduensisp+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia albertiip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniig+p+wgs, Escherichia marmotaep, Klebsiella aerogenesg+p+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p+wgs, Morganella morganiip+wgs, Proteus mirabilisg+wgs+gi, Raoultella planticolap+wgs, Salmonella entericag+p+wgs+gi, Serratia liquefaciensp, Serratia marcescensg+p+wgs+gi, Shigella boydiip+wgs, Shigella dysenteriaewgs, Shigella flexnerip+wgs, Shigella sonneip+wgs
Publications

Hata M, et al. 2005. Antimicrob Agents Chemother 49(2): 801-803. Cloning of a novel gene for quinolone resistance from a transferable plasmid in Shigella flexneri 2b. (PMID 15673773)

Resistomes

Prevalence of QnrS1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.04%0%0%
Citrobacter amalonaticus0%8.33%7.27%0%0%
Citrobacter freundii0%1.23%7.74%0%0%
Citrobacter koseri0%5%0.9%0%0%
Citrobacter portucalensis0%1.47%10.81%0%0%
Citrobacter werkmanii0%10%0%0%0%
Citrobacter youngae0%9.09%6.25%0%0%
Cronobacter dublinensis0%0%2.56%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Cronobacter sakazakii0%5.13%0%0%0%
Edwardsiella tarda0%5.26%6.67%0%0%
Enterobacter asburiae0%0%5.93%0%0%
Enterobacter chengduensis0%100%16%0%0%
Enterobacter cloacae0%4.47%10.86%0%0%
Enterobacter hormaechei0.72%2.83%12.21%0%0%
Enterobacter kobei0%0.69%5.24%0%0%
Enterobacter roggenkampii0%2.42%7.55%0%0%
Escherichia albertii0%0.56%1.94%0%0%
Escherichia coli0.79%1.67%8.57%0.13%0.13%
Escherichia fergusonii1.64%1.78%31.52%0%0%
Escherichia marmotae0%3.12%0%0%0%
Klebsiella aerogenes2%3.26%7.06%0%0%
Klebsiella michiganensis0%4%7.18%0%0%
Klebsiella oxytoca0%0.68%0.42%0%0%
Klebsiella pneumoniae0.36%3.83%15.45%1.9%0%
Klebsiella quasipneumoniae0%3.81%21.32%0%0%
Leclercia adecarboxylata7.14%9.52%9.3%0%0%
Morganella morganii0%2.5%4.29%0%0%
Proteus mirabilis0.92%0%0.17%3.7%0%
Raoultella planticola0%6.98%2.56%0%0%
Salmonella enterica1.45%4.1%2.72%0.66%0%
Serratia liquefaciens0%16.67%0%0%0%
Serratia marcescens3.03%2.58%6.03%22.22%0%
Shigella boydii0%4.35%22.22%0%0%
Shigella dysenteriae0%0%6.67%0%0%
Shigella flexneri0%8.03%4.81%0%0%
Shigella sonnei0%4.85%2.78%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABF47469.1|+|QnrS1 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
METYNHTYRHHNFSHKDLSDLTFTACTFIRSDFRRANLRDTTFVNCKFIEQGDIEGCHFDVADLRDASFQQCQLAMANFSNANCYGIEFR
ACDLKGANFSRTNFAHQVSNRMYFCSAFISGCNLSYANMERVCLEKCELFENRWIGTNLAGASLKESDLSRGVFSEDVWGQFSLQGANLC
HAELDGLDPRKVDTSGIKIAAWQQELILEALGIVVYPD


>gb|DQ485529.1|+|1-657|QnrS1 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
ATGGAAACCTACAATCATACATATCGGCACCACAACTTTTCACATAAAGACTTAAGTGATCTCACCTTCACCGCTTGCACATTCATTCGC
AGCGACTTTCGACGTGCTAACTTGCGTGATACGACATTCGTCAACTGCAAGTTCATTGAACAGGGTGATATCGAAGGCTGCCACTTTGAT
GTCGCAGATCTTCGTGATGCAAGTTTCCAACAATGCCAACTTGCGATGGCAAACTTCAGTAATGCCAATTGCTACGGTATAGAGTTCCGT
GCGTGTGATTTAAAAGGTGCCAACTTTTCCCGAACAAACTTTGCCCATCAAGTGAGTAATCGTATGTACTTTTGCTCAGCATTTATTTCT
GGATGTAATCTTTCCTATGCCAATATGGAGAGGGTTTGTTTAGAAAAATGTGAGTTGTTTGAAAATCGCTGGATAGGAACGAACCTAGCG
GGTGCATCACTGAAAGAGTCAGACTTAAGTCGAGGTGTTTTTTCCGAAGATGTCTGGGGGCAATTTAGCCTACAGGGTGCCAATTTATGC
CACGCCGAACTCGACGGTTTAGATCCCCGCAAAGTCGATACATCAGGTATCAAAATTGCAGCCTGGCAGCAAGAACTGATTCTCGAAGCA
CTGGGTATTGTTGTTTATCCTGACTAA

Curator Acknowledgements
Curator Description Most Recent Edit