QnrS2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002791
CARD Short NameQnrS2
DefinitionQnrS2 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAeromonas (10), Escherichia coli (5), Klebsiella pneumoniae (3), Aeromonas hydrophila (3), Salmonella (2), Pseudoalteromonas (2)
GAZ
FOODON
ENVOhospital (2)
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas caviaep+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+p+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs+gi, Shigella flexnerip, Vibrio alginolyticuswgs, Vibrio parahaemolyticuswgs, Vibrio vulnificusp
Resistomes with Sequence VariantsAeromonas caviaep+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+p+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs+gi, Shigella flexnerip, Vibrio alginolyticuswgs, Vibrio parahaemolyticuswgs, Vibrio vulnificusp
Publications

Gay K, et al. 2006. Clin Infect Dis 43(3): 297-304. Plasmid-mediated quinolone resistance in non-Typhi serotypes of Salmonella enterica. (PMID 16804843)

Resistomes

Prevalence of QnrS2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae0%2.6%8.06%0%0%
Aeromonas hydrophila0%3.9%4.84%0%0%
Aeromonas veronii1.82%7.69%3.37%0%0%
Citrobacter freundii0%0.31%0.58%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0%0.26%0%0%
Enterobacter kobei0%2.76%1.31%0%0%
Enterobacter roggenkampii0%0%1.08%0%0%
Escherichia albertii0%0.56%0.65%0%0%
Escherichia coli0.05%0.08%0.62%0%0%
Escherichia fergusonii0%0.71%1.09%0%0%
Klebsiella pneumoniae0%0%0.04%0%0%
Klebsiella quasipneumoniae0%0%0.26%0%0%
Leclercia adecarboxylata0%0%37.21%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Salmonella enterica0.19%0.33%0.31%0.99%0%
Shigella flexneri0%0.4%0%0%0%
Vibrio alginolyticus0%0%1.19%0%0%
Vibrio parahaemolyticus0%0%0.31%0%0%
Vibrio vulnificus0%5.56%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABF47470.1|+|QnrS2 [Salmonella enterica subsp. enterica serovar Anatum]
METYRHTYRHHSFSHQDLSDITFTACTFIRCDFRRANLRDATFINCKFIEQGDIEGCHFDVADLRDASFQQCQLAMANFSNANCYGIELR
ECDLKGANFSRANFANQVSNRMYFCSAFITGCNLSYANMERVCLEKCELFENRWIGTHLAGASLKESDLSRGVFSEDVWGQFSLQGANLC
HAELDGLDPRKVDTSGIKIASWQQEQLLEALGIVVFPD


>gb|DQ485530.1|+|1-657|QnrS2 [Salmonella enterica subsp. enterica serovar Anatum]
ATGGAAACCTACCGTCACACATATCGACACCACAGTTTTTCACATCAAGATCTAAGTGATATTACTTTCACTGCTTGCACCTTTATCCGA
TGCGATTTTCGACGTGCTAACTTGCGTGATGCGACATTTATTAACTGCAAGTTCATTGAACAGGGTGATATCGAAGGTTGCCATTTTGAT
GTCGCAGACCTTCGCGATGCAAGTTTCCAACAATGCCAGCTTGCGATGGCAAACTTTAGTAACGCCAATTGCTACGGTATTGAGTTACGT
GAGTGTGATTTAAAAGGGGCCAACTTTTCCCGAGCAAACTTTGCCAATCAAGTGAGTAATCGTATGTACTTTTGCTCAGCCTTTATTACT
GGATGTAACCTGTCTTATGCCAATATGGAGCGGGTCTGTTTAGAAAAATGTGAGCTGTTTGAAAATCGCTGGATAGGGACTCACCTCGCG
GGCGCATCACTGAAAGAGTCAGACTTAAGTCGAGGTGTTTTTTCTGAAGATGTCTGGGGACAGTTTAGCCTACAGGGTGCTAATTTATGT
CACGCCGAACTCGACGGTTTAGATCCTCGAAAAGTCGATACATCAGGTATCAAAATTGCCAGCTGGCAACAAGAACAGCTTCTCGAAGCG
TTGGGTATTGTTGTTTTTCCTGACTAG

Curator Acknowledgements
Curator Description Most Recent Edit