QnrVC1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002799
CARD Short NameQnrVC1
DefinitionQnrVC1 is an integron-mediated quinolone resistance protein found in Vibrio cholerae.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (2)
GAZ
FOODON
ENVO
UBERON
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas caviaeg+wgs, Ectopseudomonas mendocinap+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colip, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas monteiliiwgs, Pseudomonas putidap+wgs, Shewanella putrefaciensg, Stutzerimonas stutzerig+p+wgs, Vibrio alginolyticusg+wgs, Vibrio choleraeg+wgs, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs
Resistomes with Sequence VariantsAeromonas caviaeg+wgs, Ectopseudomonas mendocinap+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colip, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas monteiliiwgs, Pseudomonas putidap+wgs, Shewanella putrefaciensg, Stutzerimonas stutzerig+p+wgs, Vibrio alginolyticusg+wgs, Vibrio choleraeg+wgs, Vibrio parahaemolyticusg+wgs, Vibrio vulnificuswgs
Publications

Fonseca EL, et al. 2008. Emerg Infect Dis 14(7): 1129-1131. New qnr gene cassettes associated with superintegron repeats in Vibrio cholerae O1. (PMID 18598639)

Resistomes

Prevalence of QnrVC1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae2.27%0%1.08%0%0%
Ectopseudomonas mendocina0%50%7.14%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0%0.09%0%0%
Enterobacter kobei0%0%1.31%0%0%
Escherichia coli0%0.01%0%0%0%
Klebsiella pneumoniae0%0%0.02%0%0%
Klebsiella quasipneumoniae0%0%0.26%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa1.99%2.92%1.89%5.56%0%
Pseudomonas monteilii0%0%7.14%0%0%
Pseudomonas putida0%4%2.67%0%0%
Shewanella putrefaciens11.11%0%0%0%0%
Stutzerimonas stutzeri3.57%9.09%3.05%0%0%
Vibrio alginolyticus3.7%0%5.16%0%0%
Vibrio cholerae0.45%0%1.41%0%0%
Vibrio parahaemolyticus0.32%0%0.46%0%0%
Vibrio vulnificus0%0%1.22%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ACC54440.2|+|QnrVC1 [Vibrio cholerae]
MEKSKQLYNQVNFSHQDLQEHIFSNCTFIHCNFKRSNLRDTQFINCTFIEQGALEGCDFSYADLRDASFKNCQLSMSHFKGANCFGIELR
DCDLKGANFSQVSFVNQVSNKMYFCSAYITGCNLSYANFEQQLIEKCDLFENRWIGANLRGASFKESDLSRGVFSEDCWEQFRVQGCDLS
HSELYGLDPRKIDLTGVKICSWQQEQLLEQLGVIIVPD


>gb|EU436855.2|+|1402-2058|QnrVC1 [Vibrio cholerae]
ATGGAAAAATCAAAGCAATTATATAATCAAGTGAACTTCTCACATCAGGACTTGCAAGAACATATCTTTAGCAATTGTACTTTTATACAT
TGTAATTTTAAGCGCTCAAACCTCCGAGATACACAGTTCATTAACTGTACTTTCATAGAGCAGGGGGCATTGGAAGGGTGCGATTTTTCT
TATGCTGATCTTCGAGATGCTTCATTTAAAAACTGTCAGCTTTCAATGTCCCATTTTAAGGGGGCAAATTGCTTTGGTATTGAACTGAGA
GATTGTGATCTTAAAGGAGCAAATTTTAGTCAAGTTAGTTTTGTAAATCAGGTTTCGAATAAAATGTACTTTTGTTCTGCATACATAACA
GGTTGTAACTTATCCTATGCCAATTTTGAGCAGCAGCTTATTGAAAAATGTGACCTGTTCGAAAATAGATGGATTGGTGCAAATCTTCGA
GGCGCTTCATTTAAAGAATCAGATTTAAGCCGTGGTGTTTTTTCGGAAGACTGCTGGGAACAGTTTAGAGTACAAGGCTGTGATTTAAGC
CATTCAGAGCTTTATGGTTTAGATCCTCGAAAGATTGATCTTACGGGTGTAAAAATATGCTCGTGGCAACAGGAACAGTTACTGGAGCAA
TTAGGGGTAATCATTGTTCCTGACTAA

Curator Acknowledgements
Curator Description Most Recent Edit