QnrVC4

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002801
CARD Short NameQnrVC4
DefinitionQnrVC4 is an integron-mediated quinolone resistance protein found in Aeromonas punctata.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+p, Aeromonas veroniig+p+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Providencia stuartiip, Pseudomonas aeruginosap+wgs, Salmonella entericawgs, Vibrio choleraeg+wgs, Vibrio fluvialiswgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+p, Aeromonas veroniig+p+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Plesiomonas shigelloidesg, Providencia stuartiip, Pseudomonas aeruginosap+wgs, Salmonella entericawgs, Vibrio choleraeg+wgs, Vibrio fluvialiswgs, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs
Publications

Pons MJ, et al. 2013. Enferm Infecc Microbiol Clin 31(3): 191-192. QnrVC, a new transferable Qnr-like family. (PMID 23098826)

Resistomes

Prevalence of QnrVC4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae2.27%0%0.54%33.33%0%
Aeromonas hydrophila3.08%2.6%0%0%0%
Aeromonas veronii5.45%3.08%2.25%0%0%
Enterobacter kobei0%0%0.44%0%0%
Escherichia coli0%0.01%0.04%0%0%
Klebsiella pneumoniae0%0.01%0.03%0%0%
Klebsiella quasipneumoniae0%0.21%0.13%0%0%
Plesiomonas shigelloides12.5%0%0%0%0%
Providencia stuartii0%2.27%0%0%0%
Pseudomonas aeruginosa0%0.29%0.03%0%0%
Salmonella enterica0%0%0.02%0%0%
Vibrio cholerae1.35%0%6.96%0%0%
Vibrio fluvialis0%0%18.67%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Vibrio vulnificus0%0%1.22%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ADI55014.1|+|QnrVC4 [Aeromonas caviae]
MDKTDQLYVQADFSHQDMSGQYFKNCKFFCCSFKRANLRDTQFVDCSFIERGELEGCDFSYSDLRDASFKNCSLSMSYFKGANCFGIEFR
ECDLKGANFAQASFMNQVSNRMYFCSAYITGCNLSYANFERQCIEKCDLFENRWIGANLSGASFKESDLSRGVFSEGCWSQCRLQGCDLS
HSELYGLDPRKVDLTGVKICSWQQEQLLEQLGLIVVPD


>gb|GQ891757.1|+|2005-2661|QnrVC4 [Aeromonas caviae]
ATGGATAAAACAGACCAGTTATATGTACAAGCAGACTTTTCACATCAAGACATGAGTGGTCAGTATTTTAAAAATTGCAAATTTTTCTGC
TGTTCCTTTAAACGAGCGAACCTCCGCGATACACAATTTGTAGATTGTTCTTTCATTGAACGAGGTGAATTAGAGGGGTGTGATTTTTCT
TACTCGGATCTTAGAGATGCATCTTTTAAAAACTGCAGTCTTTCAATGTCGTATTTCAAAGGTGCAAATTGTTTTGGTATCGAGTTCAGA
GAATGCGATTTAAAGGGTGCCAATTTTGCTCAAGCTAGCTTCATGAATCAGGTATCGAACAGAATGTATTTTTGTTCAGCTTATATAACA
GGTTGTAATCTTTCATACGCCAACTTTGAAAGGCAGTGTATCGAAAAGTGTGATTTGTTTGAGAATAGATGGATTGGCGCAAATCTGAGT
GGTGCATCATTTAAAGAGTCTGATTTAAGTCGGGGAGTATTTTCTGAAGGGTGTTGGAGCCAGTGTAGGTTGCAAGGTTGTGATTTGAGC
CACTCGGAGTTGTATGGTTTAGACCCTCGGAAAGTTGACCTTACAGGTGTAAAAATCTGTTCGTGGCAGCAAGAACAACTTTTAGAGCAA
TTAGGTTTAATAGTAGTTCCTGACTAA

Curator Acknowledgements
Curator Description Most Recent Edit