QnrVC4

Download Sequences

Accession	ARO:3002801
CARD Short Name	QnrVC4
Definition	QnrVC4 is an integron-mediated quinolone resistance protein found in Aeromonas punctata.
AMR Gene Family	quinolone resistance protein (qnr)
Drug Class	fluoroquinolone antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Perfect Matches	Aeromonas caviae^g+wgs+gi, Aeromonas hydrophila^g+p, Aeromonas veronii^g+p+wgs, Enterobacter kobei^wgs, Escherichia coli^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Providencia stuartii^p, Pseudomonas aeruginosa^p+wgs, Salmonella enterica^wgs, Vibrio cholerae^g+wgs, Vibrio fluvialis^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Aeromonas caviae^g+wgs+gi, Aeromonas hydrophila^g+p, Aeromonas veronii^g+p+wgs, Enterobacter kobei^wgs, Escherichia coli^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Plesiomonas shigelloides^g, Providencia stuartii^p, Pseudomonas aeruginosa^p+wgs, Salmonella enterica^wgs, Vibrio cholerae^g+wgs, Vibrio fluvialis^wgs, Vibrio parahaemolyticus^wgs, Vibrio vulnificus^wgs
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic target protection [Resistance Mechanism] + fluoroquinolone antibiotic [Drug Class] + sparfloxacin [Antibiotic] + norfloxacin [Antibiotic] + nalidixic acid [Antibiotic] + gatifloxacin [Antibiotic] + antibiotic target protection protein + moxifloxacin [Antibiotic] + levofloxacin [Antibiotic] + ciprofloxacin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic ciprofloxacin [Antibiotic] + quinolone resistance protein (qnr) [AMR Gene Family]
Publications	Pons MJ, et al. 2013. Enferm Infecc Microbiol Clin 31(3): 191-192. QnrVC, a new transferable Qnr-like family. (PMID 23098826)

Resistomes

Prevalence of QnrVC4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas caviae	2.27%	0%	0.54%	33.33%
Aeromonas caviae	2.27%	0%	0.54%	33.33%
Aeromonas hydrophila	3.08%	2.6%	0%	0%
Aeromonas hydrophila	3.08%	2.6%	0%	0%
Aeromonas veronii	5.45%	3.08%	1.12%	0%
Aeromonas veronii	5.45%	3.08%	1.12%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Escherichia coli	0%	0.01%	0.03%	0%
Escherichia coli	0%	0.01%	0.03%	0%
Klebsiella pneumoniae	0%	0.01%	0.03%	0%
Klebsiella pneumoniae	0%	0.01%	0.03%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.13%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.13%	0%
Plesiomonas shigelloides	0%	0%	0%	0%
Plesiomonas shigelloides	12.5%	0%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%
Pseudomonas aeruginosa	0%	0.29%	0.03%	0%
Pseudomonas aeruginosa	0%	0.29%	0.03%	0%
Salmonella enterica	0%	0%	0.02%	0%
Salmonella enterica	0%	0%	0.02%	0%
Vibrio cholerae	0.45%	0%	1.53%	0%
Vibrio cholerae	1.35%	0%	4.54%	0%
Vibrio fluvialis	0%	0%	4%	0%
Vibrio fluvialis	0%	0%	4%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%
Vibrio vulnificus	0%	0%	0%	0%
Vibrio vulnificus	0%	0%	1.22%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|ADI55014.1|+|QnrVC4 [Aeromonas caviae]
MDKTDQLYVQADFSHQDMSGQYFKNCKFFCCSFKRANLRDTQFVDCSFIERGELEGCDFSYSDLRDASFKNCSLSMSYFKGANCFGIEFR
ECDLKGANFAQASFMNQVSNRMYFCSAYITGCNLSYANFERQCIEKCDLFENRWIGANLSGASFKESDLSRGVFSEGCWSQCRLQGCDLS
HSELYGLDPRKVDLTGVKICSWQQEQLLEQLGLIVVPD

>gb|GQ891757.1|+|2005-2661|QnrVC4 [Aeromonas caviae]
ATGGATAAAACAGACCAGTTATATGTACAAGCAGACTTTTCACATCAAGACATGAGTGGTCAGTATTTTAAAAATTGCAAATTTTTCTGC
TGTTCCTTTAAACGAGCGAACCTCCGCGATACACAATTTGTAGATTGTTCTTTCATTGAACGAGGTGAATTAGAGGGGTGTGATTTTTCT
TACTCGGATCTTAGAGATGCATCTTTTAAAAACTGCAGTCTTTCAATGTCGTATTTCAAAGGTGCAAATTGTTTTGGTATCGAGTTCAGA
GAATGCGATTTAAAGGGTGCCAATTTTGCTCAAGCTAGCTTCATGAATCAGGTATCGAACAGAATGTATTTTTGTTCAGCTTATATAACA
GGTTGTAATCTTTCATACGCCAACTTTGAAAGGCAGTGTATCGAAAAGTGTGATTTGTTTGAGAATAGATGGATTGGCGCAAATCTGAGT
GGTGCATCATTTAAAGAGTCTGATTTAAGTCGGGGAGTATTTTCTGAAGGGTGTTGGAGCCAGTGTAGGTTGCAAGGTTGTGATTTGAGC
CACTCGGAGTTGTATGGTTTAGACCCTCGGAAAGTTGACCTTACAGGTGTAAAAATCTGTTCGTGGCAGCAAGAACAACTTTTAGAGCAA
TTAGGTTTAATAGTAGTTCCTGACTAA

QnrVC4

Prevalence: protein homolog model (view sequences)

Graph