QnrVC6

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002803
CARD Short NameQnrVC6
DefinitionQnrVC6 is an integron-mediated quinolone resistance protein found in Acinetobacter baumannii.
AMR Gene Familyquinolone resistance protein (qnr)
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ quinolone resistance protein (qnr) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Aeromonas caviaewgs, Aeromonas hydrophilap, Aeromonas veroniig, Pseudomonas aeruginosap+wgs, Pseudomonas putidag+p+wgs, Vibrio alginolyticuswgs, Vibrio harveyip, Vibrio parahaemolyticusp+wgs
Resistomes with Sequence VariantsAcinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Aeromonas caviaewgs, Aeromonas hydrophilap, Aeromonas veroniig, Escherichia coliwgs, Pseudomonas aeruginosap+wgs, Pseudomonas putidag+p+wgs, Vibrio alginolyticuswgs, Vibrio harveyip, Vibrio parahaemolyticusp+wgs, Vibrio vulnificuswgs
Publications

Fonseca EL, et al. 2013. J Med Microbiol 62(PT 10): 1628-1630. Epidemiology of qnrVC alleles and emergence out of the Vibrionaceae family. (PMID 23800600)

Resistomes

Prevalence of QnrVC6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter nosocomialis0%0%0.57%0%0%
Acinetobacter pittii0%0%0.28%0%0%
Aeromonas caviae0%0%0.54%0%0%
Aeromonas hydrophila0%1.3%0%0%0%
Aeromonas veronii1.82%0%0%0%0%
Escherichia coli0%0%0.01%0%0%
Pseudomonas aeruginosa0%1.75%0.11%0%0%
Pseudomonas putida2.82%4%1.07%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio harveyi0%14.29%0%0%0%
Vibrio parahaemolyticus0%0.31%0.41%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AGH08253.1|+|QnrVC6 [Vibrio parahaemolyticus]
MEKSKQLYNQVNFSHQDLQEHIFSNCTFIHCNFKRSNLRDTQFINCTFIEQGALEGCDFSYADLRDASFKDCQLSMSHFKGANCFGIELR
DCDLKGANFSQVSFVNQVSNKMYFCSAYITGCNLSYANFEQQLIEKCDLFENRWIGANLRGASFKESDLSRGVFSEDCWEQFRVQGCDLS
HSELYGLDPRKIDLTGVKICSWQQEQLLEQLGVIIVPD


>gb|KC202804.1|+|3875-4531|QnrVC6 [Vibrio parahaemolyticus]
ATGGAAAAATCAAAGCAATTATATAATCAAGTGAACTTCTCACATCAGGACTTGCAAGAACATATCTTTAGCAATTGTACTTTTATACAT
TGTAATTTTAAGCGCTCAAACCTTCGAGATACACAGTTCATTAACTGTACTTTCATAGAGCAGGGGGCACTGGAAGGGTGCGATTTTTCT
TATGCTGATCTTCGAGATGCTTCATTTAAAGATTGTCAGCTTTCAATGTCCCATTTTAAGGGGGCAAATTGCTTTGGTATTGAACTGAGA
GATTGTGATCTTAAAGGGGCAAATTTTAGCCAAGTTAGTTTTGTAAATCAGGTTTCGAATAAAATGTACTTTTGCTCTGCATACATAACA
GGTTGTAACTTATCCTATGCCAATTTTGAGCAGCAGCTTATTGAAAAATGTGACCTGTTCGAAAATAGATGGATTGGTGCAAATCTTCGA
GGCGCTTCATTTAAAGAATCAGATTTAAGTCGTGGCGTTTTTTCAGAAGACTGCTGGGAACAGTTTAGAGTACAAGGCTGTGATTTAAGT
CATTCAGAGCTTTATGGTTTAGATCCTCGAAAGATTGATCTTACAGGTGTAAAAATATGCTCGTGGCAACAGGAGCAGTTACTGGAGCAA
TTAGGGGTAATCATTGTTCCTGACTAA

Curator Acknowledgements
Curator Description Most Recent Edit