arr-2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002847
CARD Short Namearr-2
Definitionarr-2 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa.
AMR Gene Familyrifampin ADP-ribosyltransferase (Arr)
Drug Classrifamycin antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONMycobacterium (2), Pseudomonas aeruginosa (2)
GAZ
FOODON
ENVO
UBERON
Classification13 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic rifampin [Antibiotic]
+ rifampin ADP-ribosyltransferase (Arr) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs+gi, Acinetobacter pittiiwgs, Aeromonas caviaewgs, Aeromonas hydrophilawgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Pasteurella multocidag+p, Proteus mirabilisp+wgs, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosap+wgs+gi, Pseudomonas putidawgs, Salmonella entericag+p+wgs+gi, Serratia marcescenswgs, Shewanella putrefaciensp, Stutzerimonas stutzeriwgs, Vibrio alginolyticusg+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter pittiiwgs, Aeromonas caviaewgs, Aeromonas hydrophilawgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Pasteurella multocidag+p, Proteus mirabilisp+wgs, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosap+wgs+gi, Pseudomonas putidawgs, Salmonella entericag+p+wgs+gi, Serratia marcescenswgs, Shewanella putrefaciensp, Stutzerimonas stutzeriwgs, Vibrio alginolyticusg+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Publications

Tribuddharat C and Fennewald M. 1999. Antimicrob Agents Chemother 43(4): 960-962. Integron-mediated rifampin resistance in Pseudomonas aeruginosa. (PMID 10103210)

Resistomes

Prevalence of arr-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.24%1.09%3.13%1.89%0%
Acinetobacter pittii0%0%1.14%0%0%
Aeromonas caviae0%0%1.08%0%0%
Aeromonas hydrophila0%0%0.81%0%0%
Citrobacter freundii0%0.31%2.51%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%1.8%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%0.56%1.92%0%0%
Enterobacter hormaechei0%0.06%1.04%0%0%
Enterobacter roggenkampii0%0.48%0%0%0%
Escherichia albertii0%0.56%0%0%0%
Escherichia coli0.05%0.44%1.13%0%0%
Escherichia fergusonii0%0.71%16.3%0%0%
Klebsiella michiganensis0%0.57%0.53%0%0%
Klebsiella oxytoca0%0.68%0.84%0%0%
Klebsiella pneumoniae0.53%1.47%5.16%0.95%0%
Klebsiella quasipneumoniae0%0.42%5.92%0%0%
Laribacter hongkongensis0%0%4.17%0%0%
Pasteurella multocida0.71%2.17%0%0%0%
Proteus mirabilis0%6.25%0.5%0%0%
Providencia rettgeri0%0%22.29%0%0%
Providencia stuartii0%9.09%15.91%0%0%
Pseudomonas aeruginosa0%2.05%0.6%2.78%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica0.76%1.26%0.75%0.33%0%
Serratia marcescens0%0%0.13%0%0%
Shewanella putrefaciens0%20%0%0%0%
Stutzerimonas stutzeri0%0%7.63%0%0%
Vibrio alginolyticus1.23%0%0.4%0%0%
Vibrio cholerae0%0%0.06%0%0%
Vibrio parahaemolyticus0%0%0.21%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 250


>gb|AAC64366.1|+|arr-2 [Pseudomonas aeruginosa]
MVKDWIPISHDNYKQVQGPFYHGTKANLAIGDLLTTGFISHFEDGRILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFED
DPNLTNKKFPGNPTQSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED


>gb|AF078527.1|+|4388-4840|arr-2 [Pseudomonas aeruginosa]
ATGGTAAAAGATTGGATTCCCATCTCTCATGATAATTACAAGCAGGTGCAAGGACCGTTCTATCATGGAACCAAAGCCAATTTGGCGATT
GGTGACTTGCTAACCACAGGGTTCATCTCTCATTTCGAGGACGGTCGTATTCTTAAGCACATCTACTTTTCAGCCTTGATGGAGCCAGCA
GTTTGGGGAGCTGAACTTGCTATGTCACTGTCTGGCCTCGAGGGTCGCGGCTACATATACATAGTTGAGCCAACAGGACCGTTCGAAGAC
GATCCGAATCTTACGAACAAAAAATTTCCCGGTAATCCAACACAGTCCTATAGAACCTGCGAACCCTTGAGAATTGTTGGCGTTGTTGAA
GACTGGGAGGGGCATCCTGTTGAATTAATAAGGGGAATGTTGGATTCGTTAGAGGACTTAAAGCGCCGTGGTTTACACGTCATTGAAGAC
TAG

Curator Acknowledgements
Curator Description Most Recent Edit