arr-2

Download Sequences

Accession	ARO:3002847
CARD Short Name	arr-2
Definition	arr-2 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa.
AMR Gene Family	rifampin ADP-ribosyltransferase (Arr)
Drug Class	rifamycin antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+p+wgs+gi, Acinetobacter pittii^wgs, Aeromonas caviae^wgs, Aeromonas hydrophila^wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter roggenkampii^p, Escherichia albertii^p, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^p+wgs, Laribacter hongkongensis^wgs, Pasteurella multocida^g+p, Proteus mirabilis^p+wgs, Providencia rettgeri^wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^p+wgs+gi, Pseudomonas putida^wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^g+p+wgs+gi, Serratia marcescens^wgs, Shewanella putrefaciens^p, Vibrio alginolyticus^g+wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+p+wgs+gi, Acinetobacter pittii^wgs, Aeromonas caviae^wgs, Aeromonas hydrophila^wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter roggenkampii^p, Escherichia albertii^p, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^p+wgs, Laribacter hongkongensis^wgs, Pasteurella multocida^g+p, Proteus mirabilis^p+wgs, Providencia rettgeri^wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^p+wgs+gi, Pseudomonas putida^wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^g+p+wgs+gi, Serratia marcescens^wgs, Shewanella putrefaciens^p, Vibrio alginolyticus^g+wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Classification	13 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + rifamycin antibiotic [Drug Class] + rifampin inactivation enzyme + rifapentine [Antibiotic] + rifabutin [Antibiotic] + rifaximin [Antibiotic] + ADP-ribosylation of antibiotic conferring resistance + rifampin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic rifampin [Antibiotic] + rifampin ADP-ribosyltransferase (Arr) [AMR Gene Family]
Publications	Tribuddharat C and Fennewald M. 1999. Antimicrob Agents Chemother 43(4): 960-962. Integron-mediated rifampin resistance in Pseudomonas aeruginosa. (PMID 10103210)

Resistomes

Prevalence of arr-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	1.24%	1.09%	1.67%	1.89%
Acinetobacter baumannii	1.24%	1.09%	1.67%	1.89%
Acinetobacter pittii	0%	0%	0.85%	0%
Acinetobacter pittii	0%	0%	1.14%	0%
Aeromonas caviae	0%	0%	1.08%	0%
Aeromonas caviae	0%	0%	1.08%	0%
Aeromonas hydrophila	0%	0%	0.81%	0%
Aeromonas hydrophila	0%	0%	0.81%	0%
Citrobacter freundii	0%	0.31%	2.32%	0%
Citrobacter freundii	0%	0.31%	2.32%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter werkmanii	0%	0%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Enterobacter asburiae	0%	0%	0.4%	0%
Enterobacter asburiae	0%	0%	0.4%	0%
Enterobacter cloacae	0%	0.56%	1.92%	0%
Enterobacter cloacae	0%	0.56%	1.92%	0%
Enterobacter hormaechei	0%	0.06%	0.86%	0%
Enterobacter hormaechei	0%	0.06%	0.86%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%
Escherichia coli	0.05%	0.44%	0.7%	0%
Escherichia coli	0.05%	0.41%	0.69%	0%
Escherichia fergusonii	0%	0.71%	7.61%	0%
Escherichia fergusonii	0%	0.71%	7.61%	0%
Klebsiella michiganensis	0%	0.57%	0.53%	0%
Klebsiella michiganensis	0%	0.57%	0.53%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%
Klebsiella pneumoniae	0.53%	1.47%	2.83%	0.95%
Klebsiella pneumoniae	0.53%	1.45%	2.81%	0.95%
Klebsiella quasipneumoniae	0%	0.21%	5.79%	0%
Klebsiella quasipneumoniae	0%	0.42%	5.92%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%
Pasteurella multocida	0.71%	2.17%	0%	0%
Pasteurella multocida	0.71%	2.17%	0%	0%
Proteus mirabilis	0%	6.25%	0.5%	0%
Proteus mirabilis	0%	6.25%	0.5%	0%
Providencia rettgeri	0%	0%	14.01%	0%
Providencia rettgeri	0%	0%	14.01%	0%
Providencia stuartii	0%	9.09%	9.09%	0%
Providencia stuartii	0%	9.09%	9.09%	0%
Pseudomonas aeruginosa	0%	1.75%	0.5%	2.78%
Pseudomonas aeruginosa	0%	2.05%	0.5%	2.78%
Pseudomonas putida	0%	0%	0.53%	0%
Pseudomonas putida	0%	0%	0.53%	0%
Pseudomonas stutzeri	0%	0%	7.63%	0%
Pseudomonas stutzeri	0%	0%	7.63%	0%
Salmonella enterica	0.76%	1.26%	0.49%	0.33%
Salmonella enterica	0.76%	1.26%	0.47%	0.33%
Serratia marcescens	0%	0%	0.13%	0%
Serratia marcescens	0%	0%	0.13%	0%
Shewanella putrefaciens	0%	20%	0%	0%
Shewanella putrefaciens	0%	20%	0%	0%
Vibrio alginolyticus	1.23%	0%	0.4%	0%
Vibrio alginolyticus	1.23%	0%	0.4%	0%
Vibrio cholerae	0%	0%	0.06%	0%
Vibrio cholerae	0%	0%	0.06%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%
Vibrio parahaemolyticus	0%	0%	0.15%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 250

Protein
DNA

>gb|AAC64366.1|+|arr-2 [Pseudomonas aeruginosa]
MVKDWIPISHDNYKQVQGPFYHGTKANLAIGDLLTTGFISHFEDGRILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFED
DPNLTNKKFPGNPTQSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED

>gb|AF078527.1|+|4388-4840|arr-2 [Pseudomonas aeruginosa]
ATGGTAAAAGATTGGATTCCCATCTCTCATGATAATTACAAGCAGGTGCAAGGACCGTTCTATCATGGAACCAAAGCCAATTTGGCGATT
GGTGACTTGCTAACCACAGGGTTCATCTCTCATTTCGAGGACGGTCGTATTCTTAAGCACATCTACTTTTCAGCCTTGATGGAGCCAGCA
GTTTGGGGAGCTGAACTTGCTATGTCACTGTCTGGCCTCGAGGGTCGCGGCTACATATACATAGTTGAGCCAACAGGACCGTTCGAAGAC
GATCCGAATCTTACGAACAAAAAATTTCCCGGTAATCCAACACAGTCCTATAGAACCTGCGAACCCTTGAGAATTGTTGGCGTTGTTGAA
GACTGGGAGGGGCATCCTGTTGAATTAATAAGGGGAATGTTGGATTCGTTAGAGGACTTAAAGCGCCGTGGTTTACACGTCATTGAAGAC
TAG

arr-2

Prevalence: protein homolog model (view sequences)

Graph