arr-7

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002852
CARD Short Namearr-7
Definitionarr-7 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa.
AMR Gene Familyrifampin ADP-ribosyltransferase (Arr)
Drug Classrifamycin antibiotic
Resistance Mechanismantibiotic inactivation
Classification13 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic rifampin [Antibiotic]
+ rifampin ADP-ribosyltransferase (Arr) [AMR Gene Family]
Resistomes with Perfect MatchesPseudomonas aeruginosawgs+gi
Resistomes with Sequence VariantsPseudomonas aeruginosawgs+gi
Publications

Samuelsen O, et al. 2009. Antimicrob Agents Chemother 54(1): 346-352. Molecular epidemiology of metallo-beta-lactamase-producing Pseudomonas aeruginosa isolates from Norway and Sweden shows import of international clones and local clonal expansion. (PMID 19884381)

Resistomes

Prevalence of arr-7 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa0%0%0.04%1.39%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 250


>gb|CAZ48628.1|+|arr-7 [Pseudomonas aeruginosa]
MPNDWIPTSHENCSLVPGPFYHGTKAKLAIGDLLSPGHPSHFEQGRRLKHIYFAALMEPAIWGAELAMSLSRQEGRGYIYIVEPLGPFED
DPNLTNKKFPGNPTKSYRTSESLRIVEVVEDWQGHSPDVLQGMLASLEDLQRRGLAIIED


>gb|FN397623.1|+|1189-1641|arr-7 [Pseudomonas aeruginosa]
ATGCCGAATGACTGGATTCCCACCTCGCACGAAAACTGCTCGCTCGTGCCGGGGCCGTTCTACCACGGCACCAAAGCAAAACTCGCAATA
GGTGACTTGCTTTCGCCTGGACACCCGTCTCACTTTGAGCAAGGCCGTAGGCTCAAACACATCTATTTTGCCGCACTGATGGAGCCAGCC
ATCTGGGGTGCTGAGCTTGCAATGTCATTGTCACGCCAAGAGGGGCGCGGTTACATTTACATTGTTGAACCGCTCGGGCCGTTTGAGGAC
GACCCAAACCTTACAAACAAAAAATTTCCGGGCAATCCAACCAAGTCCTACCGCACCAGTGAGTCGCTACGGATTGTGGAGGTAGTAGAG
GACTGGCAAGGCCACTCACCGGATGTGCTGCAGGGCATGTTGGCATCACTGGAGGATCTTCAGCGTCGCGGCCTCGCAATCATTGAGGAC
TAG

Curator Acknowledgements
Curator Description Most Recent Edit