amrA

Accession ARO:3002982
DefinitionamrA is the efflux pump subunit of the AmrAB-OprM multidrug efflux complex. amrA corresponds to 1 locus in Pseudomonas aeruginosa PAO1 and 1 locus in Pseudomonas aeruginosa LESB58.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesBurkholderia pseudomalleig+wgs
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Jassem AN, et al. 2014. Ann Clin Microbiol Antimicrob 13(1): 2. Investigation of aminoglycoside resistance inducing conditions and a putative AmrAB-OprM efflux system in Burkholderia vietnamiensis. (PMID 24393536)

Westbrock-Wadman S, et al. 1999. Antimicrob Agents Chemother 43(12): 2975-2983. Characterization of a Pseudomonas aeruginosa efflux pump contributing to aminoglycoside impermeability. (PMID 10582892)

Resistomes

Prevalence of amrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Burkholderia cenocepacia35.71%0%98.18%
Burkholderia cepacia35.71%0%99.18%
Burkholderia pseudomallei50.51%0%98.75%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAH35803.1|-|amrA [Burkholderia pseudomallei K96243]
MKYEWARTRRLSAALAVAAFVAAGCGKHESEHDAAAPREASVVTVKKTSVPLSVELPGRLDAYRQAEVRARVAGIVTARTYEEGQEVKRG
AVLFRIDPAPFKAARDAAAGALEKARAAHLAALDKRRRYDELVRDRAVSERDHTEALADERQAKAAVASARAELARAQLQLDYATVTAPI
DGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAADVESLRRAVKSGRAAGIAQQDVEVTLVRPDGSTYARKGKLLFADLAVDP
STDTVAMRALFPNPERELLPGAYVRIALDRAVARDAILVPRDALLRTADSATVKVVGQNGKIRDVTVEAAQMKGRDWIVTRGLAGGERVV
VVDAAQFEAGTTVKALERGAAAQPASGAAAASAPGRRST


>gb|BX571965.1|-|2150966-2152165|amrA [Burkholderia pseudomallei K96243]
ATGAAATACGAATGGGCACGCACGCGCCGCTTGTCGGCGGCGCTCGCGGTCGCGGCGTTCGTCGCGGCCGGCTGCGGCAAGCACGAAAGC
GAGCACGACGCCGCCGCGCCGCGCGAGGCGAGCGTCGTCACGGTGAAGAAGACATCGGTGCCGCTGTCGGTCGAATTGCCGGGCCGGCTC
GACGCGTACCGGCAGGCCGAGGTGCGCGCGCGGGTCGCGGGCATCGTGACCGCGCGCACCTACGAGGAAGGGCAGGAAGTCAAGCGCGGC
GCGGTGCTGTTCAGGATCGATCCCGCGCCGTTCAAGGCGGCGCGCGACGCGGCCGCGGGCGCGCTCGAGAAGGCGCGGGCCGCGCACCTC
GCGGCGCTCGACAAGCGCCGCCGCTATGACGAGCTCGTGCGCGACCGCGCGGTCAGCGAGCGCGACCACACCGAGGCGCTCGCCGACGAA
CGGCAGGCGAAGGCGGCCGTCGCGTCGGCGCGCGCGGAGCTCGCGCGCGCGCAACTGCAGCTCGATTACGCGACCGTCACCGCGCCGATC
GACGGCCGCGCGCGCCGCGCGCTCGTGACCGAAGGCGCGCTCGTCGGCCAGGATCAGGCGACGCCGCTCACGACCGTCGAGCAGCTCGAT
CCGATCTACGTGAACTTCTCGCAGCCCGCGGCCGACGTCGAATCGCTGCGGCGCGCGGTGAAGAGCGGACGCGCGGCGGGCATCGCGCAG
CAGGACGTCGAGGTGACGCTCGTGCGCCCGGACGGCAGCACGTACGCGCGCAAGGGCAAGCTGCTGTTCGCGGATCTTGCCGTCGACCCG
TCCACCGACACGGTGGCGATGCGTGCGCTCTTTCCGAACCCGGAGCGCGAACTGCTGCCCGGCGCGTACGTGCGGATCGCGCTCGATCGC
GCGGTCGCGCGCGACGCGATCCTCGTGCCGCGCGACGCGCTGCTGCGCACGGCCGACAGCGCGACCGTCAAGGTCGTCGGCCAGAACGGC
AAGATACGCGACGTGACGGTCGAGGCCGCGCAGATGAAAGGCCGCGACTGGATCGTCACGCGCGGGCTCGCGGGCGGCGAGCGCGTCGTC
GTCGTCGACGCCGCGCAATTCGAAGCAGGCACGACGGTGAAGGCGCTCGAGCGCGGCGCCGCCGCGCAGCCGGCCTCCGGCGCCGCCGCG
GCTTCCGCGCCCGGCCGGCGCTCAACCTGA