amrA

Download Sequences

Accession	ARO:3002982
CARD Short Name	amrA
Definition	amrA is the efflux pump subunit of the AmrAB-OprM multidrug efflux complex. amrA corresponds to 1 locus in Pseudomonas aeruginosa PAO1 and 1 locus in Pseudomonas aeruginosa LESB58.
AMR Gene Family	resistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Class	aminoglycoside antibiotic, macrolide antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Burkholderia pseudomallei^g+wgs
Resistomes with Sequence Variants	Burkholderia ambifaria^g+wgs, Burkholderia cenocepacia^g+wgs+gi, Burkholderia cepacia^g+wgs+gi, Burkholderia contaminans^g+wgs+gi, Burkholderia dolosa^g+wgs+gi, Burkholderia lata^g+wgs, Burkholderia mallei^g+wgs, Burkholderia multivorans^g+wgs+gi, Burkholderia oklahomensis^g+wgs, Burkholderia pseudomallei^g+wgs, Burkholderia thailandensis^g+wgs, Burkholderia vietnamiensis^g+p+wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic efflux [Resistance Mechanism] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + aminoglycoside antibiotic [Drug Class] + macrolide antibiotic [Drug Class] + azithromycin [Antibiotic] + resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family] + tobramycin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + subunit of efflux pump conferring antibiotic resistance + part_of AmrAB-OprM
Publications	Jassem AN, et al. 2014. Ann Clin Microbiol Antimicrob 13(1): 2. Investigation of aminoglycoside resistance inducing conditions and a putative AmrAB-OprM efflux system in Burkholderia vietnamiensis. (PMID 24393536) Westbrock-Wadman S, et al. 1999. Antimicrob Agents Chemother 43(12): 2975-2983. Characterization of a Pseudomonas aeruginosa efflux pump contributing to aminoglycoside impermeability. (PMID 10582892)

Resistomes

Prevalence of amrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Burkholderia ambifaria	34.88%	0%	100%	0%	0%
Burkholderia ambifaria	0%	0%	0%	0%	0%
Burkholderia cenocepacia	0%	0%	0%	0%	0%
Burkholderia cenocepacia	34.67%	0%	98.25%	50%	0%
Burkholderia cepacia	34.55%	0%	99.1%	100%	0%
Burkholderia cepacia	0%	0%	0%	0%	0%
Burkholderia contaminans	0%	0%	0%	0%	0%
Burkholderia contaminans	32.65%	0%	98.75%	40%	0%
Burkholderia dolosa	33.33%	0%	100%	100%	0%
Burkholderia dolosa	0%	0%	0%	0%	0%
Burkholderia lata	0%	0%	0%	0%	0%
Burkholderia lata	33.33%	0%	100%	0%	0%
Burkholderia mallei	40.68%	0%	77.38%	0%	0%
Burkholderia mallei	0%	0%	0%	0%	0%
Burkholderia multivorans	33.33%	0%	99.76%	100%	0%
Burkholderia multivorans	0%	0%	0%	0%	0%
Burkholderia oklahomensis	0%	0%	0%	0%	0%
Burkholderia oklahomensis	50%	0%	83.33%	0%	0%
Burkholderia pseudomallei	18.9%	0%	36.91%	0%	0%
Burkholderia pseudomallei	49.83%	0%	98.62%	0%	0%
Burkholderia thailandensis	47.83%	0%	92.45%	0%	0%
Burkholderia thailandensis	0%	0%	0%	0%	0%
Burkholderia vietnamiensis	34.38%	9.09%	97.41%	0%	0%
Burkholderia vietnamiensis	0%	0%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|CAH35803.1|-|amrA [Burkholderia pseudomallei K96243]
MKYEWARTRRLSAALAVAAFVAAGCGKHESEHDAAAPREASVVTVKKTSVPLSVELPGRLDAYRQAEVRARVAGIVTARTYEEGQEVKRG
AVLFRIDPAPFKAARDAAAGALEKARAAHLAALDKRRRYDELVRDRAVSERDHTEALADERQAKAAVASARAELARAQLQLDYATVTAPI
DGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAADVESLRRAVKSGRAAGIAQQDVEVTLVRPDGSTYARKGKLLFADLAVDP
STDTVAMRALFPNPERELLPGAYVRIALDRAVARDAILVPRDALLRTADSATVKVVGQNGKIRDVTVEAAQMKGRDWIVTRGLAGGERVV
VVDAAQFEAGTTVKALERGAAAQPASGAAAASAPGRRST

>gb|BX571965.1|-|2150966-2152165|amrA [Burkholderia pseudomallei K96243]
ATGAAATACGAATGGGCACGCACGCGCCGCTTGTCGGCGGCGCTCGCGGTCGCGGCGTTCGTCGCGGCCGGCTGCGGCAAGCACGAAAGC
GAGCACGACGCCGCCGCGCCGCGCGAGGCGAGCGTCGTCACGGTGAAGAAGACATCGGTGCCGCTGTCGGTCGAATTGCCGGGCCGGCTC
GACGCGTACCGGCAGGCCGAGGTGCGCGCGCGGGTCGCGGGCATCGTGACCGCGCGCACCTACGAGGAAGGGCAGGAAGTCAAGCGCGGC
GCGGTGCTGTTCAGGATCGATCCCGCGCCGTTCAAGGCGGCGCGCGACGCGGCCGCGGGCGCGCTCGAGAAGGCGCGGGCCGCGCACCTC
GCGGCGCTCGACAAGCGCCGCCGCTATGACGAGCTCGTGCGCGACCGCGCGGTCAGCGAGCGCGACCACACCGAGGCGCTCGCCGACGAA
CGGCAGGCGAAGGCGGCCGTCGCGTCGGCGCGCGCGGAGCTCGCGCGCGCGCAACTGCAGCTCGATTACGCGACCGTCACCGCGCCGATC
GACGGCCGCGCGCGCCGCGCGCTCGTGACCGAAGGCGCGCTCGTCGGCCAGGATCAGGCGACGCCGCTCACGACCGTCGAGCAGCTCGAT
CCGATCTACGTGAACTTCTCGCAGCCCGCGGCCGACGTCGAATCGCTGCGGCGCGCGGTGAAGAGCGGACGCGCGGCGGGCATCGCGCAG
CAGGACGTCGAGGTGACGCTCGTGCGCCCGGACGGCAGCACGTACGCGCGCAAGGGCAAGCTGCTGTTCGCGGATCTTGCCGTCGACCCG
TCCACCGACACGGTGGCGATGCGTGCGCTCTTTCCGAACCCGGAGCGCGAACTGCTGCCCGGCGCGTACGTGCGGATCGCGCTCGATCGC
GCGGTCGCGCGCGACGCGATCCTCGTGCCGCGCGACGCGCTGCTGCGCACGGCCGACAGCGCGACCGTCAAGGTCGTCGGCCAGAACGGC
AAGATACGCGACGTGACGGTCGAGGCCGCGCAGATGAAAGGCCGCGACTGGATCGTCACGCGCGGGCTCGCGGGCGGCGAGCGCGTCGTC
GTCGTCGACGCCGCGCAATTCGAAGCAGGCACGACGGTGAAGGCGCTCGAGCGCGGCGCCGCCGCGCAGCCGGCCTCCGGCGCCGCCGCG
GCTTCCGCGCCCGGCCGGCGCTCAACCTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

amrA

Prevalence: protein homolog model (view sequences)

Graph