AAC(6')-Ib'

Accession ARO:3003676
CARD Short NameAAC(6')-Ib'
DefinitionAAC(6')-Ib' is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in P. aeruginosa and P. fluorescens.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas veroniip, Enterobacter hormaecheip+wgs, Escherichia colip, Klebsiella michiganensisp, Klebsiella pneumoniaep+wgs, Laribacter hongkongensiswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Pseudomonas monteiliiwgs, Salmonella entericawgs
Resistomes with Sequence VariantsAcinetobacter baumanniip+wgs, Aeromonas veroniip, Citrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Klebsiella michiganensisp, Klebsiella pneumoniaep+wgs, Laribacter hongkongensiswgs, Providencia rettgeriwgs, Pseudomonas aeruginosap+wgs, Pseudomonas monteiliiwgs, Salmonella entericawgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
Publications

MacLeod DL, et al. 2000. J. Infect. Dis. 181(3):1180-4 Aminoglycoside-resistance mechanisms for cystic fibrosis Pseudomonas aeruginosa isolates are unchanged by long-term, intermittent, inhaled tobramycin treatment. (PMID 10720551)

Lambert T, et al. 1994. FEMS Microbiol Lett 115(2-3): 297-304. A spontaneous point mutation in the aac(6')-Ib' gene results in altered substrate specificity of aminoglycoside 6'-N-acetyltransferase of a Pseudomonas fluorescens strain. (PMID 8138142)

Resistomes

Prevalence of AAC(6')-Ib' among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0.06%0.69%0%
Aeromonas veronii0%2.33%0%0%
Citrobacter freundii0%0%0.24%0%
Enterobacter cloacae0%0%1.08%0%
Enterobacter hormaechei0%0.51%0.23%0%
Escherichia coli0%0.01%0.01%0%
Klebsiella michiganensis0%0.74%0%0%
Klebsiella pneumoniae0%0.34%0.42%0%
Laribacter hongkongensis0%0%2.08%0%
Providencia rettgeri0%0%8.09%0%
Pseudomonas aeruginosa0%0.32%0.68%0%
Pseudomonas monteilii0%0%5%0%
Salmonella enterica0%0%0.05%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAT74613.1|+|AAC(6')-Ib' [Pseudomonas aeruginosa]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERT
RSVA


>gb|AY660529.1|+|122-676|AAC(6')-Ib' [Pseudomonas aeruginosa]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGTTGCCTAA