AAC(6')-Ib'

Download Sequences

Accession	ARO:3003676
CARD Short Name	AAC(6')-Ib'
Definition	AAC(6')-Ib' is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in P. aeruginosa and P. fluorescens.
AMR Gene Family	AAC(6')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^p+wgs, Aeromonas veronii^p, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Escherichia coli^p, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Laribacter hongkongensis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas monteilii^wgs, Salmonella enterica^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^p+wgs, Aeromonas veronii^p, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Escherichia coli^p, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Laribacter hongkongensis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas monteilii^wgs, Salmonella enterica^wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + determinant of antibiotic resistance + antibiotic inactivation enzyme + antibiotic molecule + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + AAC(6') [AMR Gene Family]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic amikacin [Antibiotic] + AAC(6')-I
Publications	MacLeod DL, et al. 2000. J. Infect. Dis. 181(3):1180-4 Aminoglycoside-resistance mechanisms for cystic fibrosis Pseudomonas aeruginosa isolates are unchanged by long-term, intermittent, inhaled tobramycin treatment. (PMID 10720551) Lambert T, et al. 1994. FEMS Microbiol Lett 115(2-3): 297-304. A spontaneous point mutation in the aac(6')-Ib' gene results in altered substrate specificity of aminoglycoside 6'-N-acetyltransferase of a Pseudomonas fluorescens strain. (PMID 8138142)

Resistomes

Prevalence of AAC(6')-Ib' among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0%	0.05%	0.29%	0%
Acinetobacter baumannii	0%	0.1%	0.71%	0%
Aeromonas veronii	0%	1.54%	0%	0%
Aeromonas veronii	0%	1.54%	0%	0%
Enterobacter hormaechei	0%	0.26%	0.09%	0%
Enterobacter hormaechei	0%	0.26%	0.26%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Escherichia coli	0%	0.01%	0%	0%
Escherichia coli	0%	0.01%	0%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%
Klebsiella pneumoniae	0%	0.01%	0.03%	0%
Klebsiella pneumoniae	0%	0.28%	0.12%	0%
Klebsiella quasipneumoniae	0%	0%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.26%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%
Providencia rettgeri	0%	0%	3.82%	0%
Providencia rettgeri	0%	0%	7.01%	0%
Pseudomonas aeruginosa	0%	0%	0.23%	0%
Pseudomonas aeruginosa	0%	0%	0.53%	0%
Pseudomonas monteilii	0%	0%	4.76%	0%
Pseudomonas monteilii	0%	0%	4.76%	0%
Salmonella enterica	0%	0%	0.05%	0%
Salmonella enterica	0%	0%	0.05%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275

Protein
DNA

>gb|AAT74613.1|+|AAC(6')-Ib' [Pseudomonas aeruginosa]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERT
RSVA

>gb|AY660529.1|+|122-676|AAC(6')-Ib' [Pseudomonas aeruginosa]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGTTGCCTAA

AAC(6')-Ib'

Prevalence: protein homolog model (view sequences)

Graph