adeC

Accession ARO:3003811
DefinitionAdeC is the outer membrane factor of the AdeABC multidrug efflux complex. It can be replaced by other outer membrane channels, and is not essential for antibiotic resistance.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, glycylcycline, triclosan, penam, aminocoumarin antibiotic, antibacterial free fatty acids, aminoglycoside antibiotic, fluoroquinolone antibiotic, macrolide antibiotic, carbapenem, phenicol antibiotic, acridine dye, diaminopyrimidine antibiotic, monobactam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAcinetobacter baumanniig+wgs
Classification25 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Coyne S, et al. 2011. Antimicrob Agents Chemother 55(3): 947-953. Efflux-mediated antibiotic resistance in Acinetobacter spp. (PMID 21173183)

Resistomes

Prevalence of adeC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii70.06%0%78.67%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 850


>gb|ALX99516.1|+|adeC [Acinetobacter baumannii]
MSKSTIVSRGLILSTLSIALVACVNMQAPQPAITSHIPQNFSQNHSGKMIAEKSYKEFISDPKLLQVIEISLNNNRDLRTATLNIERVQQ
EYQITKNSQLPTIGVTGNAVRQVSPSINPNNPVSTFQVGLGMTAYELDFWGRVQNLKDAALNNYLATQSAKEAVQIGLISNITQVWLNYA
FAQANLNLAEQTLKAQVDAYNLNKKRFDVGIDSEVPLKQAQISVETARNDVATYKTQIQQAKNLLDLLAGHPVPQNLLPDHAIQNITFEK
NFAAGLPSDLLNHRPDLKAAEYELRVAGANIGAAKARMFPTISLTGSTGYASSELKDLFKTGNFAWSIGPNIDLPIFDWGTRKTNIKIAE
TDQKIALAKYEKAIQSAFREVNDALATHAHIGERLDAQRRLVSATAATYKLSMARYKAGVDSYFTVLDAQRSAYAAQQGLLALEQIKLNN
QIEIYKVLGGGISKV


>gb|CP013924.1|+|2063743-2065140|adeC [Acinetobacter baumannii]
ATGTCTAAATCGACAATCGTATCTCGTGGACTCATTCTTTCTACACTCTCAATTGCACTCGTTGCATGTGTCAATATGCAAGCGCCACAG
CCTGCAATTACATCTCATATTCCTCAAAATTTTAGTCAAAATCATTCTGGAAAAATGATTGCAGAAAAAAGTTATAAAGAATTTATTTCT
GATCCGAAATTATTACAGGTCATTGAAATCAGTTTAAATAACAACCGTGATTTACGGACTGCTACGCTTAATATTGAACGTGTACAGCAA
GAATACCAAATCACAAAAAATAGCCAGCTCCCAACCATTGGTGTAACGGGAAATGCAGTGCGGCAGGTTAGCCCATCGATTAACCCCAAT
AACCCAGTTTCTACATTTCAAGTTGGCTTGGGAATGACTGCCTATGAGCTAGATTTTTGGGGCCGTGTTCAAAATTTAAAAGATGCTGCA
TTAAATAACTATCTTGCAACTCAAAGTGCAAAAGAAGCTGTACAAATTGGTTTAATCAGTAATATTACACAGGTCTGGTTAAATTATGCT
TTTGCACAAGCAAATTTAAACCTTGCCGAGCAAACCTTAAAAGCACAAGTCGATGCTTATAACCTTAACAAGAAGCGCTTTGATGTTGGT
ATTGATAGTGAAGTGCCATTAAAACAAGCACAAATTTCGGTAGAGACTGCTCGAAATGATGTTGCAACTTATAAAACTCAAATTCAACAG
GCAAAAAATTTACTGGATTTGTTAGCAGGTCATCCTGTTCCGCAAAATTTACTTCCGGATCATGCTATTCAAAATATTACCTTTGAGAAA
AACTTTGCAGCCGGTTTACCAAGTGATTTATTAAATCATCGTCCAGACCTTAAAGCTGCCGAATATGAGTTACGTGTTGCAGGAGCAAAT
ATTGGTGCTGCTAAAGCACGGATGTTCCCAACCATAAGCTTGACAGGCTCGACGGGTTATGCATCATCTGAACTGAAAGATTTATTTAAA
ACAGGCAATTTTGCATGGTCGATTGGACCTAATATCGATCTACCAATTTTTGATTGGGGAACAAGAAAAACTAATATTAAAATTGCGGAA
ACTGACCAGAAAATTGCTTTAGCTAAATATGAAAAAGCCATTCAATCAGCTTTTCGTGAAGTTAATGATGCACTTGCTACACATGCACAT
ATTGGTGAACGATTAGACGCTCAGCGTCGCTTAGTCTCTGCGACTGCTGCAACCTATAAACTCTCAATGGCACGTTACAAAGCTGGAGTG
GATAGTTATTTTACGGTTTTAGATGCTCAGCGTTCTGCTTATGCTGCACAACAAGGCTTACTTGCACTTGAACAAATAAAATTAAATAAC
CAAATTGAAATTTATAAAGTTTTAGGAGGAGGAATATCAAAAGTCTAA