mgrB

Accession ARO:3003820
DefinitionmgrB is a small transmembrane protein produced in the PhoPQ signalling system. It acts as a negative regulator in this system. Inactivation or down-regulation of mgrB confers colistin resistance by absence as shown in Klebsiella pneumoniae
AMR Gene Familypmr phosphoethanolamine transferase, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, acridine dye, macrolide antibiotic, penam, fluoroquinolone antibiotic, rifamycin antibiotic, tetracycline antibiotic, pleuromutilin antibiotic, cephalosporin, nitroimidazole antibiotic
Resistance Mechanismantibiotic target alteration, antibiotic efflux, resistance by absence
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Classification35 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Poirel L, et al. 2015. J. Antimicrob. Chemother. 70(1):75-80 The mgrB gene as a key target for acquired resistance to colistin in Klebsiella pneumoniae. (PMID 25190723)

Resistomes

Prevalence of mgrB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 75


>gb|NP_416340.1|-|mgrB [Escherichia coli str. K-12 substr. MG1655]
MKKFRWVVLVVVVLACLLLWAQVFNMMCDQDVQFFSGICAINQFIPW


>gb|NC_000913.3|-|1908623-1908766|mgrB [Escherichia coli str. K-12 substr. MG1655]
TCACCACGGGATAAACTGGTTAATGGCACAAATTCCGCTGAAAAATTGTACATCCTGATCGCACATCATGTTGAATACCTGCGCCCAAAG
CAGCAAGCAAGCCAACACCACGACAACCAGAACGACCCATCGAAACTTTTTCAC