ANT(4')-Ib

Accession ARO:3003905
Synonym(s)aadD2
CARD Short NameANT(4')-Ib
DefinitionKanamycin nucleotidyltransferase sequence from Staphylococcus aureus plasmid. Confers resistance to kanamycin, neomycin and other aminoglycosides.
AMR Gene FamilyANT(4')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesBacillus subtilisg, Enterococcus faecalisp+wgs, Enterococcus faeciumwgs, Klebsiella quasipneumoniaep, Staphylococcus arlettaep, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg, Staphylococcus epidermidisg+p+wgs, Staphylococcus haemolyticusg+p, Staphylococcus schleiferig, Staphylococcus warnerip, Streptococcus suiswgs
Resistomes with Sequence VariantsBacillus subtilisg+wgs, Bacillus thuringiensisp+wgs, Bacillus velezensiswgs, Enterobacter hormaecheiwgs, Enterococcus faecalisp+wgs, Enterococcus faeciumwgs, Escherichia coliwgs, Klebsiella quasipneumoniaep, Proteus mirabiliswgs, Providencia alcalifacienswgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Staphylococcus arlettaep+wgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus haemolyticusg+p+wgs, Staphylococcus hominisp+wgs, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus schleiferig, Staphylococcus warnerip+wgs, Stenotrophomonas maltophiliawgs, Streptococcus suiswgs
Classification20 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ ANT(4') [AMR Gene Family]
Publications

McDougal LK, et al. 2010. Antimicrob. Agents Chemother. 54(9):3804-11 Emergence of resistance among USA300 methicillin-resistant Staphylococcus aureus isolates causing invasive disease in the United States. (PMID 20585117)

Resistomes

Prevalence of ANT(4')-Ib among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Bacillus subtilis2.26%0%0.65%0%
Bacillus thuringiensis0%0.2%0.48%0%
Bacillus velezensis0%0%0.92%0%
Enterobacter hormaechei0%0%0.05%0%
Enterococcus faecalis0%1.66%0.87%0%
Enterococcus faecium0%0%0.27%0%
Escherichia coli0%0%0.04%0%
Klebsiella quasipneumoniae0%0.27%0%0%
Proteus mirabilis0%0%0.27%0%
Providencia alcalifaciens0%0%3.7%0%
Pseudomonas aeruginosa0%0%0.06%0%
Salmonella enterica0%0%0.01%0%
Staphylococcus arlettae0%11.11%2.5%0%
Staphylococcus aureus8.26%5.79%10.57%0%
Staphylococcus capitis42.86%0%13.07%0%
Staphylococcus epidermidis2.73%2.33%19.87%0%
Staphylococcus haemolyticus12.5%2.33%11.21%0%
Staphylococcus hominis0%2.17%13.85%0%
Staphylococcus pasteuri0%0%4.17%0%
Staphylococcus pseudintermedius0%0%0.53%0%
Staphylococcus saprophyticus0%0%0.75%0%
Staphylococcus schleiferi28.57%0%0%0%
Staphylococcus warneri0%7.69%5.26%0%
Stenotrophomonas maltophilia0%0%0.52%0%
Streptococcus suis0%0%1.39%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|ADA62098.1|-|ANT(4')-Ib [Staphylococcus aureus]
MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYAS
QVESDWPLTHGQFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLPSLTVQVAMAGAMLIGLH
HRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF


>gb|GQ900432.1|-|26738-27499|ANT(4')-Ib [Staphylococcus aureus]
GTGAATGGACCAATAATAATGACTAGAGAAGAAAGAATGAAGATTGTTCATGAAATTAAGGAACGAATATTGGATAAATATGGGGATGAT
GTTAAGGCTATTGGTGTTTATGGCTCTCTTGGTCGTCAGACTGATGGGCCCTATTCGGATATTGAGATGATGTGTGTCATGTCAACAGAG
GAAGCAGAGTTCAGCCATGAATGGACAACCGGTGAGTGGAAGGTGGAAGTGAATTTTGATAGCGAAGAGATTCTACTAGATTATGCATCT
CAGGTGGAATCAGATTGGCCGCTTACACATGGTCAATTTTTCTCTATTTTGCCGATTTATGATTCAGGTGGATACTTAGAGAAAGTGTAT
CAAACTGCTAAATCGGTAGAAGCCCAAACGTTCCACGATGCGATTTGTGCCCTTATCGTAGAAGAGCTGTTTGAATATGCAGGCAAATGG
CGTAATATTCGTGTGCAAGGACCGACAACATTTCTACCATCCTTGACTGTACAGGTAGCAATGGCAGGTGCCATGTTGATTGGTCTGCAT
CATCGCATCTGTTATACGACGAGCGCTTCGGTCTTAACTGAAGCAGTTAAGCAATCAGATCTTCCTTCAGGTTATGACCATCTGTGCCAG
TTCGTAATGTCTGGTCAACTTTCCGACTCTGAGAAACTTCTGGAATCGCTAGAGAATTTCTGGAATGGGATTCAGGAGTGGACAGAACGA
CACGGATATATAGTGGATGTGTCAAAACGCATACCATTTTGA