hp1181

Accession ARO:3003964
Definitionhp1181 is a translocase that is part of the MFS efflux pump family. It is found in H. pylori and has role in the active efflux of antibiotics.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, benzalkonium chloride, phenicol antibiotic, peptide antibiotic, glycylcycline, rhodamine, isoniazid, fosfomycin, fluoroquinolone antibiotic, rifamycin antibiotic, bicyclomycin, macrolide antibiotic, nitroimidazole antibiotic, antibacterial free fatty acids, penam, nucleoside antibiotic, diaminopyrimidine antibiotic, oxazolidinone antibiotic, acridine dye, cephalosporin, lincosamide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesHelicobacter pylorig+wgs
Classification30 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic metronidazole [Antibiotic]
Publications

Falsafi T, et al. 2016. Jundishapur J Microbiol 9(4):e30726 Association of hp1181 and hp1184 Genes With the Active Efflux Phenotype in Multidrug-Resistant Isolates of Helicobacter pylori. (PMID 27303615)

Resistomes

Prevalence of hp1181 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Helicobacter pylori100%0%99.3%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 850


>gb|AAD08227.1|+|hp1181 [Helicobacter pylori 26695]
MFKKIFPLALVSSLRFLGLFIVLPVISLYADSFHSSSPLLVGLAVGGAYLTQIVFQTPMGILSDKIGRKVVVMVCLLLFLAGSLVCFIAN
DIVWLVIGRFIQGMGALGGVISAMVADEVKEEERTKAMAIMGAFIFISFTISMAIGPGVVAFLGGAKWLFLLTAILTLLSLLMLLKVKDA
PKISYQIKNIKAYQPNSKALYLLYLSSFFEKAFMTLIFVLIPLALVNEFHKDESFLILVYVPGALLGVLSMGIASVMAEKYNKPKGVMLS
GVLLFIVSYLCLFLADSSFLGKYLWLFIVGVAFFFIGFATLEPIMQSLASKFAKVHEKGKVLGQFTTFGYLGSFVGGVSGGLSYHHLGVS
NTSLIVVALGLIWGLSLFLLNNPSKQKNVYFPLDAYNEEQFETLEDKIIEWYVNISEEIIIVKYNSDHISEEEIIHLAQNFRK


>gb|AE000511.1|+|1249488-1250819|hp1181 [Helicobacter pylori 26695]
ATGTTTAAGAAAATTTTTCCATTAGCGTTAGTGTCATCGTTGCGGTTTTTGGGGCTTTTTATTGTTTTGCCGGTCATTAGTTTGTATGCG
GATAGTTTCCATTCAAGCAGTCCCTTACTCGTGGGGTTGGCTGTGGGCGGAGCGTATCTTACGCAAATTGTTTTTCAAACCCCCATGGGC
ATTCTTAGCGATAAGATAGGCCGTAAAGTGGTGGTTATGGTGTGCTTGCTGTTGTTTTTAGCCGGCTCGTTAGTGTGCTTTATAGCGAAT
GATATTGTTTGGCTCGTTATAGGGCGCTTCATTCAAGGCATGGGGGCTTTAGGGGGGGTTATTAGTGCGATGGTGGCGGATGAAGTGAAA
GAAGAAGAGCGCACCAAAGCCATGGCCATCATGGGAGCGTTTATTTTCATTAGCTTCACTATAAGCATGGCGATTGGCCCTGGGGTTGTA
GCGTTTTTGGGGGGGGCAAAATGGCTCTTTTTACTCACGGCGATCTTAACTTTATTGAGTTTATTGATGCTTTTAAAAGTCAAAGACGCC
CCTAAAATTTCTTACCAGATCAAAAACATAAAAGCTTACCAACCCAACTCTAAAGCCTTGTATCTTTTGTATCTAAGCTCTTTTTTTGAA
AAAGCGTTCATGACGCTTATTTTTGTGCTGATCCCTTTAGCCTTAGTGAATGAATTTCATAAAGATGAAAGCTTTTTAATCTTGGTGTAT
GTGCCTGGAGCCTTATTAGGGGTCTTAAGCATGGGAATAGCGAGCGTTATGGCTGAAAAATACAACAAGCCTAAAGGAGTGATGCTTTCT
GGCGTATTATTGTTTATTGTGAGTTATTTGTGCTTGTTTTTAGCCGACTCTAGCTTTTTAGGGAAATATTTATGGCTTTTTATTGTTGGG
GTGGCGTTTTTCTTTATTGGTTTTGCCACCTTAGAGCCTATCATGCAATCTTTAGCGTCTAAATTCGCCAAAGTGCATGAAAAAGGCAAG
GTTTTAGGGCAATTCACTACTTTTGGCTATTTAGGGAGCTTTGTTGGGGGCGTGAGCGGGGGGTTGAGCTACCATCATTTAGGCGTTTCT
AACACAAGCTTGATCGTTGTAGCTTTAGGGCTTATTTGGGGGCTATCGCTCTTTTTACTCAACAACCCTTCCAAGCAAAAAAATGTCTAT
TTCCCCTTAGACGCTTACAATGAGGAACAATTTGAAACTTTAGAGGATAAAATCATTGAATGGTATGTTAATATTAGCGAAGAAATCATT
ATTGTGAAATATAATTCCGATCACATTAGCGAAGAAGAAATCATTCACTTAGCGCAAAACTTTAGAAAATAA