HMB-1

Accession ARO:3004092
CARD Short NameHMB-1
DefinitionShotgun cloning of beta-lactam resistant P. aeruginosa NRZ-03096 yielded a clone producing a novel subclass B1 enzyme with only 74.3% identity to the next nearest relative, KHM-1. The novel MBL was named HMB-1 (for Hamburg MBL). HMB-1 gene was chromosomally located as part of a Tn 3 family transposon that was named Tn 6345, where expression of bla HMB-1 in E. coli TOP10 led to increased resistance to beta-lactams.
AMR Gene FamilyHMB beta-lactamase
Drug Classcarbapenem
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsPseudomonas aeruginosawgs
Classification13 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ HMB beta-lactamase [AMR Gene Family]
Publications

Pfennigwerth N, et al. 2017. J. Antimicrob. Chemother. 72(4):1068-1073 Genetic and biochemical characterization of HMB-1, a novel subclass B1 metallo-β-lactamase found in a Pseudomonas aeruginosa clinical isolate. (PMID 28065891)

Resistomes

Prevalence of HMB-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Pseudomonas aeruginosa0%0%0.03%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|AMY61250.1|+|HMB-1 [Pseudomonas aeruginosa]
MKIHLWISLGLLLLTNIVLAEEPLPELEVKKIDEGVYLHTSYENYPSWGLVASHGLVFVDGKDAYIIDTPATVKDTEVLVQWINDQGFKP
KASISTHFHDDSTIGIAYLNSKSIPTYASEQTNELLNKEVAAQATHSFKKNPYWLLKNKIEAFYPGAGHTPDNLVVWLPKQKILFGGCFV
KPEGLGNLSHAVVSEWPASAEKLINRYSDAKIVVPGHGTMGDASLLEKTKQRALEAVAKKK


>gb|KU961660.2|+|2032-2757|HMB-1 [Pseudomonas aeruginosa]
ATGAAAATACATTTATGGATATCATTGGGTCTTTTGCTGCTGACAAACATCGTTCTTGCAGAAGAACCGCTACCCGAACTGGAAGTTAAA
AAAATCGATGAGGGTGTTTATCTGCATACGTCCTATGAAAATTATCCAAGCTGGGGCTTGGTTGCATCCCACGGTTTGGTTTTTGTGGAT
GGTAAAGACGCTTACATTATTGATACACCCGCTACTGTTAAAGACACAGAAGTGTTAGTGCAATGGATTAACGATCAAGGCTTCAAACCC
AAGGCCAGCATTTCTACGCACTTTCACGATGACAGCACCATCGGCATTGCCTACTTAAATTCCAAATCCATTCCGACCTACGCATCAGAA
CAAACTAATGAATTGCTTAATAAAGAAGTCGCTGCACAGGCAACGCATTCGTTTAAGAAAAATCCTTATTGGCTGTTAAAAAATAAAATC
GAAGCTTTTTATCCGGGCGCTGGCCACACGCCTGACAATTTAGTGGTGTGGTTGCCGAAGCAGAAAATTCTATTCGGTGGCTGTTTTGTA
AAACCCGAAGGGCTGGGAAATTTAAGCCATGCGGTAGTTTCTGAATGGCCTGCTTCTGCAGAAAAACTTATCAATCGCTATAGCGACGCA
AAAATCGTAGTACCGGGTCATGGAACAATGGGCGATGCATCGCTGCTGGAAAAAACCAAACAGCGTGCGCTTGAGGCGGTTGCAAAGAAG
AAATAA