kamB

Accession ARO:3004102
DefinitionMethyltransferase enzyme first described in Streptoalloteichus tenebrarius. Confers resistance to aminoglycoside antibiotics (esp. apramycin) through methylation of the 16S rRNA at A1408, thereby modifying the antibiotic target.
AMR Gene Family16S rRNA methyltransferase (A1408)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
Classification10 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic apramycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ 16S rRNA methyltransferase (A1408) [AMR Gene Family]
Publications

Witek MA, et al. 2014. Biochim. Biophys. Acta 1844(9):1648-55 Expansion of the aminoglycoside-resistance 16S rRNA (m(1)A1408) methyltransferase family: expression and functional characterization of four hypothetical enzymes of diverse bacterial origin. (PMID 24963996)

Savic M, et al. 2009. Nucleic Acids Res. 37(16):5420-31 Determination of the target nucleosides for members of two families of 16S rRNA methyltransferases that confer resistance to partially overlapping groups of aminoglycoside antibiotics. (PMID 19589804)

Resistomes

Prevalence of kamB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|WP_063964000.1|+|kamB [Streptoalloteichus tenebrarius]
MRRVVGKRVQEFSDAEFEQLRSQYDDVVLDVGTGDGKHPYKVARQNPSRLVVALDADKSRMEKISAKAAAKPAKGGLPNLLYLWATAERL
PPLSGVGELHVLMPWGSLLRGVLGSSPEMLRGMAAVCRPGASFLVALNLHAWRPSVPEVGEHPEPTPDSADEWLAPRYAEAGWKLADCRY
LEPEEVAGLETSWTRRLHSSRDRFDVLALTGTISP


>gb|NG_050561.1|+|101-748|kamB [Streptoalloteichus tenebrarius]
ATGCGCCGCGTGGTGGGCAAGCGGGTCCAGGAGTTCTCCGACGCCGAGTTCGAGCAGCTACGGAGTCAGTACGACGACGTGGTGCTCGAC
GTCGGCACCGGCGACGGGAAGCATCCGTACAAGGTCGCCCGCCAGAACCCCTCCCGGCTGGTGGTGGCGCTCGACGCCGACAAGAGCCGG
ATGGAGAAGATCTCGGCGAAGGCGGCGGCCAAGCCCGCGAAGGGCGGCCTGCCCAACCTGCTGTACCTGTGGGCCACCGCCGAGCGGCTC
CCCCCGTTGTCGGGGGTGGGCGAGCTGCACGTCCTCATGCCGTGGGGCAGCCTGCTGCGCGGGGTCCTCGGCTCCTCGCCGGAGATGCTG
CGCGGGATGGCGGCGGTGTGCCGGCCGGGCGCGTCCTTCCTGGTCGCGCTGAACCTGCACGCCTGGCGGCCCTCGGTGCCGGAGGTGGGC
GAGCACCCCGAGCCCACCCCGGACTCCGCCGACGAGTGGCTGGCGCCCCGCTACGCCGAGGCCGGGTGGAAGCTCGCCGACTGCCGCTAC
CTGGAGCCGGAGGAGGTGGCGGGTCTGGAGACCTCCTGGACCCGCCGTCTGCACTCCTCCCGCGACCGGTTCGACGTGCTCGCGCTCACC
GGCACGATCAGTCCGTGA