Escherichia coli LamB

Accession ARO:3004126
DefinitionLamB is a negative regulator for antibiotic resistance, it serves as a porin to influx antibiotic. When down-regulated, it increases resistance to chlortetracycline, ciprofloxacin, balofloxacin and nalidixic acid. It also interacts with Odp1, an energy metabolic enzyme, creating a complex that decreases in antibiotic-resistant strains.
AMR Gene FamilySugar Porin (SP)
Drug Classfluoroquinolone antibiotic, tetracycline antibiotic
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification11 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic chlortetracycline [Antibiotic]
+ confers_resistance_to_antibiotic nalidixic acid [Antibiotic]
+ gene conferring resistance via absence
+ confers_resistance_to_antibiotic balofloxacin [Antibiotic]
+ Sugar Porin (SP) [AMR Gene Family]
Publications

Lin XM, et al. 2014. J Proteomics 98:244-53 Decreased expression of LamB and Odp1 complex is crucial for antibiotic resistance in Escherichia coli. (PMID 24412198)

Makino K, et al. 1999. Genes Genet Syst 74(5): 227-239. Complete nucleotide sequence of the prophage VT2-Sakai carrying the verotoxin 2 genes of the enterohemorrhagic Escherichia coli O157:H7 derived from the Sakai outbreak. (PMID 10734605)

Zhang DF, et al. 2008. Int. J. Antimicrob. Agents 32(4):315-9 Functional characterisation of altered outer membrane proteins for tetracycline resistance in Escherichia coli. (PMID 18620846)

Resistomes

Prevalence of Escherichia coli LamB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 850

Type of Antibiotic Resistance: Intrinsic or chromosomally-encoded


>gb|BAB38442|+|Escherichia coli LamB [Escherichia coli O157:H7 str. Sakai]
MMITLRKLPLAVAVAAGVMSAQAMAVDFHGYARSGIGWTGSGGEQQCFQTTGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVA
YSVAQQNDWEATDPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLENIDVGFGKLSLAATRSSEAGGSSSF
ASNNIYDYTNETANDVFDVRLAQMEVNPGGTLELGVDYGRANLRDNYRLVDGASKDGWLFTAEHTQSVLKGFNKFVVQYATDSMTSQGKG
LSQGSGVAFDNEKFAYNINNNGHMLRILDHGAISMGDNWDMMYVGMYQDINWDNDNGTKWWTVGIRPMYKWTPIMSTVMEIGYDNVESQR
TGDKNNQYKITLAQQWQAGDSIWSRPAIRVFATYAKWDEKWGYDYNGDSKVNPNYGKAVPADFNGGSFGRGDSDEWTFGAQMEIWW


>gb|BA000007|+|5101245-5102585|Escherichia coli LamB [Escherichia coli O157:H7 str. Sakai]
ATGATGATTACTCTGCGCAAACTTCCTCTGGCGGTTGCCGTCGCAGCGGGCGTAATGTCTGCTCAGGCAATGGCTGTTGATTTCCACGGC
TATGCACGTTCCGGTATTGGCTGGACAGGTAGCGGCGGTGAACAACAGTGTTTCCAGACTACCGGTGCTCAAAGTAAATACCGTCTTGGC
AACGAATGTGAAACTTATGCTGAATTAAAATTGGGTCAGGAAGTGTGGAAAGAGGGCGATAAGAGCTTCTATTTCGACACTAACGTGGCC
TATTCCGTCGCGCAACAGAATGACTGGGAAGCTACCGACCCGGCCTTCCGTGAAGCAAACGTGCAGGGTAAAAACCTGATCGAATGGCTG
CCAGGCTCCACCATCTGGGCAGGTAAGCGCTTCTACCAACGTCATGACGTTCATATGATCGACTTCTACTACTGGGATATTTCTGGTCCT
GGTGCCGGTCTGGAAAACATCGATGTTGGCTTCGGTAAACTCTCTCTGGCAGCAACCCGCTCCTCTGAAGCAGGTGGTTCTTCCTCTTTC
GCCAGCAACAATATTTATGACTATACCAACGAAACCGCGAACGACGTTTTCGATGTGCGTTTAGCGCAGATGGAAGTCAACCCGGGCGGC
ACATTAGAACTGGGTGTCGACTACGGTCGTGCCAACCTGCGTGATAACTATCGTCTGGTTGATGGCGCATCGAAAGACGGCTGGTTATTC
ACTGCTGAACATACTCAGAGTGTCCTGAAGGGCTTTAACAAGTTTGTTGTTCAGTACGCTACTGACTCGATGACCTCGCAGGGTAAAGGT
CTGTCGCAGGGTTCTGGCGTTGCATTTGATAACGAAAAATTTGCCTACAATATCAACAACAACGGTCACATGCTGCGTATCCTCGACCAC
GGTGCGATCTCCATGGGCGACAACTGGGACATGATGTACGTGGGTATGTACCAGGATATCAACTGGGATAACGACAACGGCACCAAGTGG
TGGACCGTCGGTATTCGCCCGATGTACAAGTGGACGCCAATCATGAGCACCGTGATGGAAATCGGCTACGACAACGTCGAATCCCAGCGC
ACCGGCGACAAGAACAATCAGTACAAAATTACCCTCGCACAACAATGGCAGGCTGGCGACAGCATCTGGTCACGCCCGGCTATTCGTGTC
TTCGCAACCTACGCCAAGTGGGATGAGAAATGGGGTTACGACTACAACGGCGATAGCAAGGTTAACCCGAACTACGGCAAAGCCGTTCCT
GCTGATTTCAACGGCGGCAGCTTCGGTCGTGGCGACAGCGACGAGTGGACCTTCGGTGCCCAGATGGAAATCTGGTGGTAA