tet(W/N/W)

Accession ARO:3004442
Synonym(s)tetWNW
CARD Short Nametet(W/N/W)
Definitiontet(W/N/W) is a mosaic tetracycline resistance gene and ribosomal protection protein.
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
Resistomes with Sequence VariantsBacteroides fragiliswgs, Bifidobacterium animalisg, Bifidobacterium brevewgs, Bifidobacterium longumwgs, Collinsella aerofacienswgs, Klebsiella pneumoniaewgs, Lactobacillus johnsoniig, Streptococcus suiswgs
Classification7 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic minocycline [Antibiotic]
+ confers_resistance_to_antibiotic chlortetracycline [Antibiotic]
Publications

Leclercq SO, et al. 2016. Appl. Environ. Microbiol. 82(21):6454-6462 Diversity of the Tetracycline Mobilome within a Chinese Pig Manure Sample. (PMID 27565618)

Resistomes

Prevalence of tet(W/N/W) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Bacteroides fragilis0%0%0.36%0%
Bifidobacterium animalis2.78%0%0%0%
Bifidobacterium breve0%0%0.89%0%
Bifidobacterium longum0%0%0.22%0%
Collinsella aerofaciens0%0%2.74%0%
Klebsiella pneumoniae0%0%0.01%0%
Lactobacillus johnsonii5.56%0%0%0%
Streptococcus suis0%0%0.06%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AMP42147.1|+|tet(W/N/W) [uncultured bacterium IN-02]
MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLA
VLDGAILVISAKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVYQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQPIGEQGGAALCGSVFKVEYTDCGQRLVYLRL
YSGTLRLRDTVALAGREKLKITEMRIPSKGEIVRTDTAHKGEIVILPSDSLRLNDILGDKTQLPREMWSDVPFPMLRTTITPKTAEQRDR
LLDALTQIADTDPLLHYEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPTVIYMERPLKAASHTIHIEVPPNPFWASIGLSVT
PLPLGSGVQYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL
SFTLYAPREYLSRAYHDAPKYCATIETVQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGRSVCLTELKGYQATVGEPIIQPRRPNSRLDK
VRHMFSKIP


>gb|KU736867.1|+|19654-21573|tet(W/N/W) [uncultured bacterium IN-02]
ATGAAAATAATCAATATTGGAATTCTTGCCCATGTAGACGCTGGAAAGACGACCTTGACGGAGAGCCTGCTATATGCCAGCGGAGCCATT
TCAGAACCGGGGAGCGTCGAAAAAGGGACAACGAGGACGGACACCATGTTTTTGGAGCGGCAGCGTGGGATTACCATTCAAGCGGCAGTC
ACTTCCTTCCAGTGGCACAGATGTAAAGTTAACATTGTGGATACGCCCGGCCACATGGATTTTTTGGCGGAGGTGTACCGCTCTTTGGCT
GTTTTAGATGGGGCCATCTTGGTGATCTCCGCTAAAGATGGCGTGCAGGCCCAGACCCGTATTCTGTTCCATGCCCTGCGGAAAATGAAC
ATTCCCACCGTTATCTTTATCAACAAGATCGACCAGGCTGGCGTTGATTTGCAGAGCGTATATCAGTCTGTTCGGGATAAGCTCTCCGCC
GATATTATCATCAAGCAGACGGTGTCGCTGTCCCCGGAAATAGTCCTGGAGGAAAATACCGACATAGAAGCATGGGATGCGGTCATCGAA
AATAACGATGAATTATTGGAAAAGTATATCGCAGGAGAACCAATCAGCCGGGAAAAACTTGCGCGGGAGGAACAGCAGCGGGTTCAAGAC
GCCTCCCTGTTCCCAGTCTATCATGGCAGCGCCAAAAATGGCCTTGGCATTCAACCGTTGATGGATGCGGTGACAGGGCTGTTCCAACCG
ATTGGGGAACAGGGGGGCGCCGCCCTATGCGGCAGCGTTTTCAAGGTGGAGTATACAGATTGCGGCCAGAGGCTTGTCTATCTGCGGCTA
TACAGCGGAACGCTGCGTCTGCGGGATACGGTGGCCCTAGCCGGGAGAGAAAAGCTGAAAATCACAGAGATGCGTATTCCATCCAAAGGG
GAGATTGTTCGGACAGATACCGCCCATAAGGGCGAAATTGTCATCCTTCCCAGCGACAGCTTGAGATTAAACGATATATTGGGGGACAAA
ACCCAACTTCCTCGTGAAATGTGGAGTGATGTTCCCTTCCCTATGCTGCGGACGACGATTACGCCAAAAACGGCAGAGCAAAGAGACCGG
TTGCTGGACGCTCTTACGCAAATTGCGGATACTGACCCGCTTTTGCACTACGAGGTGGATTCCATCACCCATGAGATCATTCTTTCTTTT
TTGGGCCGGGTGCAGTTGGAGGTTGTTTCCGCTTTGCTGTCGGAAAAATACAAGCTTGAAACAGTGGTAAAGGAACCCACCGTCATTTAT
ATGGAGCGGCCGCTCAAAGCAGCCAGCCACACCATCCATATCGAGGTGCCGCCCAACCCGTTTTGGGCATCCATCGGACTGTCTGTTACA
CCACTCCCGCTTGGCTCCGGTGTACAATACGAGAGCCGGGTTTCGCTGGGATACTTGAACCAGAGTTTTCAAAACGCTGTCAGGGATGGT
ATCCGTTACGGGCTGGAGCAGGGCTTGTTCGGCTGGAACGTAACGGACTGTAAGATTTGCTTTGAATACGGGCTTTATTACAGTCCGGTC
AGCACGCCGGCGGACTTCCGCTCATTGGCCCCGATTGTATTGGAACAGGCATTGAAGGAATCAGGGACGCAACTGCTGGAACCTTATCTC
TCCTTCACCCTCTATGCGCCCCGGGAATATCTTTCCAGGGCTTATCATGATGCACCGAAATACTGTGCCACCATCGAAACGGTCCAGGTA
AAAAAGGATGAAGTTGTCTTTACTGGCGAGATTCCCGCCCGTTGCATACAGGCATACCGTACTGATTTGGCCTTTTACACCAACGGGCGG
AGTGTGTGCCTGACGGAACTGAAAGGGTATCAGGCCACTGTCGGCGAGCCAATCATCCAGCCCCGTCGTCCAAACAGCCGTTTGGATAAG
GTGCGCCATATGTTCAGTAAGATTCCTTGA