tet(W/N/W)

Accession ARO:3004442
Synonym(s)tetWNW
Definitiontet(W/N/W) is a mosaic tetracycline resistance gene and ribosomal protection protein.
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_drug tetracycline [Antibiotic]
+ confers_resistance_to_drug minocycline [Antibiotic]
+ confers_resistance_to_drug chlortetracycline [Antibiotic]
Publications

Leclercq SO, et al. 2016. Appl. Environ. Microbiol. 82(21):6454-6462 Diversity of the Tetracycline Mobilome within a Chinese Pig Manure Sample. (PMID 27565618)

Resistomes

Prevalence of tet(W/N/W) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Campylobacter coli0%27.5%4.91%
Campylobacter jejuni0%18.42%7.42%
Chlamydia trachomatis0%0%2.56%
Clostridioides difficile15.38%0%7.79%
Clostridium botulinum0%0%0.54%
Enterococcus faecalis28.57%2.7%32.18%
Enterococcus faecium56.9%1.01%49.17%
Escherichia coli0.31%0.58%1.79%
Haemophilus parainfluenzae0%0%2.63%
Klebsiella pneumoniae0%0%0.06%
Listeria monocytogenes1.02%0%2.75%
Neisseria gonorrhoeae0%8.33%8.16%
Neisseria meningitidis0%0%0.16%
Salmonella enterica0%0.18%0.28%
Shigella sonnei0%0%1.45%
Staphylococcus aureus19.2%0.05%15.31%
Staphylococcus epidermidis0%0%0.19%
Staphylococcus intermedius16.67%0%27.59%
Staphylococcus pseudintermedius50%0%51.54%
Streptococcus agalactiae50.85%0%54.22%
Streptococcus anginosus60%0%31.71%
Streptococcus constellatus100%0%27.27%
Streptococcus pneumoniae40%0%36.73%
Streptococcus pyogenes11.67%0%8.41%
Vibrio vulnificus0%0%0.89%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AMP42147.1|+|tet(W/N/W) [uncultured bacterium IN-02]
MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLA
VLDGAILVISAKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVYQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQPIGEQGGAALCGSVFKVEYTDCGQRLVYLRL
YSGTLRLRDTVALAGREKLKITEMRIPSKGEIVRTDTAHKGEIVILPSDSLRLNDILGDKTQLPREMWSDVPFPMLRTTITPKTAEQRDR
LLDALTQIADTDPLLHYEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPTVIYMERPLKAASHTIHIEVPPNPFWASIGLSVT
PLPLGSGVQYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL
SFTLYAPREYLSRAYHDAPKYCATIETVQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGRSVCLTELKGYQATVGEPIIQPRRPNSRLDK
VRHMFSKIP


>gb|KU736867.1|+|19654-21573|tet(W/N/W) [uncultured bacterium IN-02]
ATGAAAATAATCAATATTGGAATTCTTGCCCATGTAGACGCTGGAAAGACGACCTTGACGGAGAGCCTGCTATATGCCAGCGGAGCCATT
TCAGAACCGGGGAGCGTCGAAAAAGGGACAACGAGGACGGACACCATGTTTTTGGAGCGGCAGCGTGGGATTACCATTCAAGCGGCAGTC
ACTTCCTTCCAGTGGCACAGATGTAAAGTTAACATTGTGGATACGCCCGGCCACATGGATTTTTTGGCGGAGGTGTACCGCTCTTTGGCT
GTTTTAGATGGGGCCATCTTGGTGATCTCCGCTAAAGATGGCGTGCAGGCCCAGACCCGTATTCTGTTCCATGCCCTGCGGAAAATGAAC
ATTCCCACCGTTATCTTTATCAACAAGATCGACCAGGCTGGCGTTGATTTGCAGAGCGTATATCAGTCTGTTCGGGATAAGCTCTCCGCC
GATATTATCATCAAGCAGACGGTGTCGCTGTCCCCGGAAATAGTCCTGGAGGAAAATACCGACATAGAAGCATGGGATGCGGTCATCGAA
AATAACGATGAATTATTGGAAAAGTATATCGCAGGAGAACCAATCAGCCGGGAAAAACTTGCGCGGGAGGAACAGCAGCGGGTTCAAGAC
GCCTCCCTGTTCCCAGTCTATCATGGCAGCGCCAAAAATGGCCTTGGCATTCAACCGTTGATGGATGCGGTGACAGGGCTGTTCCAACCG
ATTGGGGAACAGGGGGGCGCCGCCCTATGCGGCAGCGTTTTCAAGGTGGAGTATACAGATTGCGGCCAGAGGCTTGTCTATCTGCGGCTA
TACAGCGGAACGCTGCGTCTGCGGGATACGGTGGCCCTAGCCGGGAGAGAAAAGCTGAAAATCACAGAGATGCGTATTCCATCCAAAGGG
GAGATTGTTCGGACAGATACCGCCCATAAGGGCGAAATTGTCATCCTTCCCAGCGACAGCTTGAGATTAAACGATATATTGGGGGACAAA
ACCCAACTTCCTCGTGAAATGTGGAGTGATGTTCCCTTCCCTATGCTGCGGACGACGATTACGCCAAAAACGGCAGAGCAAAGAGACCGG
TTGCTGGACGCTCTTACGCAAATTGCGGATACTGACCCGCTTTTGCACTACGAGGTGGATTCCATCACCCATGAGATCATTCTTTCTTTT
TTGGGCCGGGTGCAGTTGGAGGTTGTTTCCGCTTTGCTGTCGGAAAAATACAAGCTTGAAACAGTGGTAAAGGAACCCACCGTCATTTAT
ATGGAGCGGCCGCTCAAAGCAGCCAGCCACACCATCCATATCGAGGTGCCGCCCAACCCGTTTTGGGCATCCATCGGACTGTCTGTTACA
CCACTCCCGCTTGGCTCCGGTGTACAATACGAGAGCCGGGTTTCGCTGGGATACTTGAACCAGAGTTTTCAAAACGCTGTCAGGGATGGT
ATCCGTTACGGGCTGGAGCAGGGCTTGTTCGGCTGGAACGTAACGGACTGTAAGATTTGCTTTGAATACGGGCTTTATTACAGTCCGGTC
AGCACGCCGGCGGACTTCCGCTCATTGGCCCCGATTGTATTGGAACAGGCATTGAAGGAATCAGGGACGCAACTGCTGGAACCTTATCTC
TCCTTCACCCTCTATGCGCCCCGGGAATATCTTTCCAGGGCTTATCATGATGCACCGAAATACTGTGCCACCATCGAAACGGTCCAGGTA
AAAAAGGATGAAGTTGTCTTTACTGGCGAGATTCCCGCCCGTTGCATACAGGCATACCGTACTGATTTGGCCTTTTACACCAACGGGCGG
AGTGTGTGCCTGACGGAACTGAAAGGGTATCAGGCCACTGTCGGCGAGCCAATCATCCAGCCCCGTCGTCCAAACAGCCGTTTGGATAAG
GTGCGCCATATGTTCAGTAAGATTCCTTGA