AAC(3)-IIe

Download Sequences
Accession ARO:3004621
Synonym(s)aacC2e
CARD Short NameAAC(3)-IIe
DefinitionAAC(3)-IIe is a plasmid-encoded aminoglycoside acetyltransferase in E. coli.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter indicuswgs, Acinetobacter johnsoniiwgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp, Acinetobacter pittiip, Acinetobacter radioresistenswgs, Avibacterium paragallinarumwgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Pseudomonas monteiliiwgs, Raoultella planticolawgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Classification12 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 6'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(3)-II
Publications

Ho PL, et al. 2010. J. Med. Microbiol. 59(Pt 6):702-7 Genetic identity of aminoglycoside-resistance genes in Escherichia coli isolates from human and animal sources. (PMID 20185552)
Resistomes

Prevalence of AAC(3)-IIe among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.77%0.42%5.22%0%0%
Acinetobacter indicus0%0%1.3%0%0%
Acinetobacter johnsonii0%0%1.82%0%0%
Acinetobacter lwoffii0%0%2.63%0%0%
Acinetobacter nosocomialis0%1.64%0%0%0%
Acinetobacter pittii0%0.49%0%0%0%
Acinetobacter radioresistens0%0%5.26%0%0%
Avibacterium paragallinarum0%0%5.88%0%0%
Citrobacter freundii0.82%1.54%6.19%0%0%
Citrobacter koseri0%0%1.8%0%0%
Citrobacter portucalensis0%0%4.5%0%0%
Citrobacter werkmanii0%0%56.41%0%0%
Enterobacter asburiae0%0.28%5.53%0%0%
Enterobacter chengduensis0%0%20%0%0%
Enterobacter cloacae1.79%0.56%9.27%0%0%
Enterobacter hormaechei0.72%0.39%11.78%0%0%
Enterobacter kobei0%0%5.24%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli0.6%0.66%3.84%0%0%
Klebsiella aerogenes0%3.26%2.26%0%0%
Klebsiella michiganensis0%1.71%4.26%0%0%
Klebsiella oxytoca0%1.37%3.78%0%0%
Klebsiella pneumoniae1.07%2.29%16.79%0%0%
Klebsiella quasipneumoniae0%0.64%4.87%0%0%
Morganella morganii3.85%0%4.29%0%0%
Proteus mirabilis2.75%0%6.11%0%0%
Providencia rettgeri2.94%0%0.64%0%0%
Providencia stuartii0%0%9.09%0%0%
Pseudomonas aeruginosa0%0%0.21%0%0%
Pseudomonas monteilii0%0%2.38%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0%0.22%0.23%0%0%
Serratia marcescens0%1.29%2.88%0%0%
Shigella boydii0%0%2.22%0%0%
Shigella flexneri0%0.4%0.31%0%0%
Shigella sonnei0%0%0.73%0%0%
Vibrio cholerae0%0%1.6%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 565


>gb|ABS70978.1|+|AAC(3)-IIe [Escherichia coli]
MHTRKAITEAIRKFGVQTGDLLMVHASLKAIGPVEGGAETVVAALRSAVGPTGTVMGYASWDRSPYEETLNGARLDDKARRTWPPFDPAT
AGTYRGFGLLNQFLVQAPGARRSAHPDASMVAVGPLAETLTEPHELGHALGEGSPVERFVRLGGKALLLGAPLNSVTALHYAEAVADIPN
KRWVTYEMPMLGRNGEVAWKTASEYDSNGILDCFAIEGKPDAVETIANAYVKLGRHREGVVGFAQCYLFDAQDIVTFGVTYLEKHFGATP
IVPAQKAAQRSCEPSG


>gb|EU022315.1|+|1-861|AAC(3)-IIe [Escherichia coli]
ATGCATACGCGGAAGGCAATAACGGAGGCAATTCGAAAATTCGGAGTCCAAACCGGTGACCTGTTGATGGTGCATGCCTCACTTAAAGCG
ATTGGTCCGGTCGAAGGAGGAGCGGAGACGGTCGTTGCCGCGTTACGCTCCGCGGTTGGGCCGACTGGCACTGTGATGGGATACGCGTCG
TGGGACCGATCACCCTACGAGGAGACTCTGAATGGCGCTCGGTTGGATGACAAAGCCCGCCGTACCTGGCCGCCGTTCGATCCCGCAACG
GCCGGGACTTACCGTGGGTTCGGCCTGCTGAATCAATTTCTGGTTCAAGCCCCCGGCGCGCGGCGCAGCGCGCACCCCGATGCATCGATG
GTCGCGGTTGGTCCGCTAGCTGAAACGCTGACGGAGCCTCACGAACTCGGTCACGCCTTGGGGGAAGGGTCGCCCGTCGAGCGGTTCGTC
CGCCTTGGCGGGAAGGCCCTGCTGTTGGGTGCGCCGCTAAACTCCGTTACCGCATTGCACTACGCCGAGGCGGTTGCGGATATCCCCAAC
AAACGATGGGTGACGTATGAGATGCCGATGCTTGGAAGAAACGGTGAAGTCGCCTGGAAAACGGCATCAGAATACGATTCAAACGGCATT
CTCGATTGCTTTGCTATCGAAGGAAAGCCGGATGCGGTCGAAACTATAGCAAATGCTTACGTGAAGCTCGGTCGCCATCGAGAAGGTGTC
GTGGGCTTTGCTCAGTGCTACCTGTTCGACGCGCAGGACATCGTGACGTTCGGCGTCACCTATCTTGAGAAGCACTTCGGAGCCACTCCG
ATCGTGCCAGCACAGAAAGCCGCCCAGCGCTCTTGCGAGCCTTCAGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit