Staphylococcus aureus norA

Accession ARO:3004667
DefinitionNorA gene cloned from Staphylococcus aureus conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin in S. aureus and Escherichia coli. Had low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesStaphylococcus aureusg+wgs
Classification7 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
Publications

Yoshida H, et al. 1990. J Bacteriol 172(12): 6942-6949. Nucleotide sequence and characterization of the Staphylococcus aureus norA gene, which confers resistance to quinolones. (PMID 2174864)

Resistomes

Prevalence of Staphylococcus aureus norA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0%0.13%
Staphylococcus aureus99.76%0%98.95%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|BAA14147.1|+|Staphylococcus aureus norA [Staphylococcus aureus]
MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHN
FSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELT
FIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
MAIGVSLAGVVIVLIEKQHRAKLKEQNM


>gb|D90119.1|+|478-1644|Staphylococcus aureus norA [Staphylococcus aureus]
ATGAATAAACAGATTTTTGTCTTATATTTTAATATTTTCTTGATTTTTTTAGGTATCGGTTTAGTAATACCAGTCTTGCCTGTTTATTTA
AAAGATTTGGGATTAACTGGTAGTGATTTAGGATTACTAGTTGCTGCTTTTGCGTTATCTCAAATGATTATATCGCCGTTTGGTGGTACG
CTAGCTGACAAATTAGGGAAGAAATTAATTATATGTATAGGATTAATTTTGTTTTCAGTGTCAGAATTTATGTTTGCAGTTGGCCACAAT
TTTTCGGTATTGATGTTATCGAGAGTGATTGGTGGTATGAGTGCTGGTATGGTAATGCCTGGTGTGACAGGTTTAATAGCTGACATTTCA
CCAAGCCATCAAAAAGCAAAAAACTTTGGCTACATGTCAGCGATTATCAATTCTGGATTCATTTTAGGACCAGGGATTGGTGGATTTATG
GCAGAAGTTTCACATCGTATGCCATTTTACTTTGCAGGAGCATTAGGTATTCTAGCATTTATAATGTCAATTGTATTGATTCACGATCCG
AAAAAGTCTACGACAAGTGGTTTCCAAAAGTTAGAGCCACAATTGCTAACGAAAATTAACTGGAAAGTGTTTATTACACCAGTTATTTTA
ACACTTGTATTATCGTTTGGTTTATCTGCATTTGAAACATTGTATTCACTATACACAGCTGACAAGGTAAATTATTCACCTAAAGATATT
TCGATTGCTATTACGGGTGGCGGTATATTTGGGGCACTTTTCCAAATCTATTTCTTCGATAAATTTATGAAGTATTTCTCAGAGTTAACA
TTTATAGCTTGGTCATTATTATATTCAGTTGTTGTCTTAATATTATTAGTTTTTGCTAATGGCTATTGGTCAATAATGTTAATCAGTTTT
GTTGTCTTCATAGGTTTTGATATGATACGACCAGCCATTACAAATTATTTTTCTAATATTGCTGGAGAAAGGCAAGGCTTTGCAGGCGGA
TTGAACTCGACATTCACTAGTATGGGTAATTTCATAGGTCCTTTAATCGCAGGTGCGTTATTTGATGTACACATTGAAGCACCAATTTAT
ATGGCTATAGGTGTTTCATTAGCAGGTGTTGTTATTGTTTTAATTGAAAAGCAACATAGAGCAAAATTGAAAGAACAAAATATGTAG