Staphylococcus aureus norA

Accession ARO:3004667
CARD Short NameSaur_norA
DefinitionNorA gene cloned from Staphylococcus aureus conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin in S. aureus and Escherichia coli. Had low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsEnterococcus faecaliswgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosawgs, Staphylococcus aureusg+wgs, Streptococcus suiswgs, Vibrio choleraewgs
Classification7 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
Publications

Yoshida H, et al. 1990. J Bacteriol 172(12): 6942-6949. Nucleotide sequence and characterization of the Staphylococcus aureus norA gene, which confers resistance to quinolones. (PMID 2174864)

Resistomes

Prevalence of Staphylococcus aureus norA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterococcus faecalis0%0%0.05%0%
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0%0.01%0%
Pseudomonas aeruginosa0%0%0.02%0%
Staphylococcus aureus98.19%0%58.7%0%
Streptococcus suis0%0%0.06%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|BAA14147.1|+|Staphylococcus aureus norA [Staphylococcus aureus]
MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHN
FSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELT
FIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
MAIGVSLAGVVIVLIEKQHRAKLKEQNM


>gb|D90119.1|+|478-1644|Staphylococcus aureus norA [Staphylococcus aureus]
ATGAATAAACAGATTTTTGTCTTATATTTTAATATTTTCTTGATTTTTTTAGGTATCGGTTTAGTAATACCAGTCTTGCCTGTTTATTTA
AAAGATTTGGGATTAACTGGTAGTGATTTAGGATTACTAGTTGCTGCTTTTGCGTTATCTCAAATGATTATATCGCCGTTTGGTGGTACG
CTAGCTGACAAATTAGGGAAGAAATTAATTATATGTATAGGATTAATTTTGTTTTCAGTGTCAGAATTTATGTTTGCAGTTGGCCACAAT
TTTTCGGTATTGATGTTATCGAGAGTGATTGGTGGTATGAGTGCTGGTATGGTAATGCCTGGTGTGACAGGTTTAATAGCTGACATTTCA
CCAAGCCATCAAAAAGCAAAAAACTTTGGCTACATGTCAGCGATTATCAATTCTGGATTCATTTTAGGACCAGGGATTGGTGGATTTATG
GCAGAAGTTTCACATCGTATGCCATTTTACTTTGCAGGAGCATTAGGTATTCTAGCATTTATAATGTCAATTGTATTGATTCACGATCCG
AAAAAGTCTACGACAAGTGGTTTCCAAAAGTTAGAGCCACAATTGCTAACGAAAATTAACTGGAAAGTGTTTATTACACCAGTTATTTTA
ACACTTGTATTATCGTTTGGTTTATCTGCATTTGAAACATTGTATTCACTATACACAGCTGACAAGGTAAATTATTCACCTAAAGATATT
TCGATTGCTATTACGGGTGGCGGTATATTTGGGGCACTTTTCCAAATCTATTTCTTCGATAAATTTATGAAGTATTTCTCAGAGTTAACA
TTTATAGCTTGGTCATTATTATATTCAGTTGTTGTCTTAATATTATTAGTTTTTGCTAATGGCTATTGGTCAATAATGTTAATCAGTTTT
GTTGTCTTCATAGGTTTTGATATGATACGACCAGCCATTACAAATTATTTTTCTAATATTGCTGGAGAAAGGCAAGGCTTTGCAGGCGGA
TTGAACTCGACATTCACTAGTATGGGTAATTTCATAGGTCCTTTAATCGCAGGTGCGTTATTTGATGTACACATTGAAGCACCAATTTAT
ATGGCTATAGGTGTTTCATTAGCAGGTGTTGTTATTGTTTTAATTGAAAAGCAACATAGAGCAAAATTGAAAGAACAAAATATGTAG