AAC(3)-IIg

Download Sequences
Accession ARO:3005085
CARD Short NameAAC(3)-IIg
DefinitionAAC(3)-IIg is part of the AAC(3) family. It was initially found in clinical isolates of Enterobacter cloacae.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAeromonas veroniip, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Providencia stuartiip, Salmonella entericap+wgs, Serratia marcescensp+wgs
Resistomes with Sequence VariantsAeromonas veroniip, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Providencia stuartiip, Salmonella entericap+wgs, Serratia marcescensp+wgs
Classification12 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 6'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(3)-II
Publications

Zhu X, et al. 2020. Antimicrob. Agents Chemother. : Prevalence of Aminoglycoside Resistance Genes and Molecular Characterization of a Novel Gene aac(3)-IIg among Clinical Isolates of Enterobacter cloacae Complex from a Chinese Teaching Hospital. (PMID 32571822)
Resistomes

Prevalence of AAC(3)-IIg among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas veronii0%1.54%0%0%0%
Citrobacter freundii0%0%2.13%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%1.47%0.9%0%0%
Citrobacter youngae0%0%6.25%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Enterobacter asburiae0%0.55%4.74%0%0%
Enterobacter chengduensis0%0%16%0%0%
Enterobacter cloacae0%0%4.79%0%0%
Enterobacter hormaechei0%1.93%8.93%0%0%
Enterobacter kobei0%0%6.11%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli0%0%0.07%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella oxytoca0%0%0.84%0%0%
Klebsiella pneumoniae0%0%0.26%0%0%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Providencia stuartii0%2.27%0%0%0%
Salmonella enterica0%0.05%0.14%0%0%
Serratia marcescens0%0.65%0.26%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|QKT21444.1|+|AAC(3)-IIg [Enterobacter cloacae]
MNTRETIAADLSRLGVQSGALVMVHASLKAIGPVDGGAASIVSALLDAVGPTGSLMGYASWDRSPYEETLNGARMDAELRHRWPPFDPAI
SGTYRGFGLLNRFLLQTPGARRSAHPDASMVAVGPLAGTLTRPHELGQAFGPGSPLERFVERAGKVLLLGAPLDSVTVLHYAEAIARIPN
KRRVSYEMPIRSEDGGVRWKRAEDFDSNGILDCFAIEGEPDAVETITNAYVELRRHREGLVGQAHCYLFEARDIVSFGVDYLQRHFGSP


>gb|MT090547.1|+|1-810|AAC(3)-IIg [Enterobacter cloacae]
ATGAACACAAGGGAAACAATTGCGGCGGACCTTTCACGGCTGGGTGTCCAATCCGGCGCTCTCGTCATGGTTCACGCATCGCTGAAGGCG
ATCGGCCCCGTCGATGGAGGCGCAGCATCGATAGTGTCTGCCCTGCTCGATGCCGTCGGCCCCACTGGAAGCTTGATGGGATACGCCTCG
TGGGACCGGTCGCCTTACGAAGAAACGCTCAATGGCGCACGGATGGATGCGGAACTGCGCCACCGATGGCCGCCGTTCGATCCAGCCATA
TCAGGCACGTATCGCGGCTTCGGCCTGCTCAACCGGTTCCTCCTCCAGACACCCGGCGCCCGGCGCAGCGCGCACCCGGATGCCTCGATG
GTCGCGGTAGGGCCTCTGGCCGGCACTCTGACGCGGCCTCACGAACTTGGGCAGGCTTTCGGACCTGGATCGCCGCTGGAGCGTTTCGTC
GAGCGTGCCGGAAAGGTTCTGTTGCTCGGAGCCCCGCTCGATTCCGTTACCGTCCTGCACTACGCCGAGGCCATTGCCCGCATCCCGAAC
AAGCGACGCGTGAGCTACGAAATGCCGATCCGCAGCGAGGACGGCGGAGTGAGATGGAAACGCGCCGAGGATTTCGACTCCAACGGCATT
CTCGATTGTTTCGCTATCGAAGGAGAGCCGGACGCCGTCGAGACAATTACCAATGCCTATGTGGAGCTGCGACGCCATCGGGAGGGCTTG
GTCGGTCAGGCGCACTGCTACTTGTTCGAAGCGCGGGATATCGTTTCGTTCGGTGTCGACTATCTTCAACGGCACTTTGGCTCGCCCTGA

Curator Acknowledgements
Curator Description Most Recent Edit