msr(G)

Accession ARO:3007042
Synonym(s)msrG
CARD Short Namemsr(G)
Definitionmsr(G) is a part of the msr subfamily of ABC-F ribosomal protection proteins.
AMR Gene Familymsr-type ABC-F protein
Drug Classstreptogramin antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target protection
Resistomes with Perfect MatchesMacrococcus canisp
Resistomes with Sequence VariantsBacillus cereusp+wgs, Listeria monocytogeneswgs, Macrococcus canisp
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ msr-type ABC-F protein [AMR Gene Family]
Publications

Fernandez JE, et al. 2021. J Antimicrob Chemother 76(1):48-54 The novel macrolide resistance genes mef(F) and msr(G) are located on a plasmid in Macrococcus canis and a transposon in Macrococcus caseolyticus. (PMID 33118027)

Resistomes

Prevalence of msr(G) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Bacillus cereus0%0.27%0.37%0%
Listeria monocytogenes0%0%0.08%0%
Macrococcus canis0%8.33%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600


>gb|QNR09092.1|+|msr(G) [Macrococcus canis]
MEQICFELENVEVTYLDKEVLKIERLAVHQFDRIGIVGKNGAGKSTLLKLLAGIIKPTTGKVNRLVENGYFEQLETPSVRDADPVLLGKL
DVPKDSNQLSGGEQTRMKLAKLFTHYYEALLIDEPTTHLDQEGISFLLDELRYYYGALVLISHDRSVLDELVTTIWEVHEGKVRIYSGNY
SDYMAQKKLEREQQSQAHEQFIKEKSRLEKAAQEKMKKAEKVAQAGRLSKKDANAKPDKSFMTKSKGTSQKAMQRAAKAIEQRMEKLQEV
DAVKEDRQINFHQSRNLELHNKFPIMADRFTLQVDNKVLLNEVSFQMPLGKKIAISGKNGAGKSTLLHHIAINAPGLTISPKAKIGYFRQ
MSYQYTRDETVLEFLKNRSEYDERFLRSVLHSMLFVGTDILKSVKSLSGGEAIRLQLCQLFLGEYNILLLDEPTNFLDIYAIEALERFIT
AYKGTIIFVSHDRRFIDCVADCIYFIEDQQLKLRG


>gb|CP046364.1|+|33123-34580|msr(G) [Macrococcus canis]
ATGGAACAAATCTGTTTTGAATTAGAAAATGTAGAAGTGACATATCTAGATAAAGAGGTTTTAAAGATTGAAAGATTAGCTGTACACCAA
TTTGACCGTATCGGCATAGTCGGTAAAAATGGTGCAGGTAAAAGCACGTTACTAAAATTACTGGCGGGTATCATTAAGCCAACAACGGGA
AAGGTGAATCGGCTTGTTGAGAATGGCTATTTTGAGCAACTTGAAACTCCATCAGTACGTGATGCTGATCCAGTGTTACTTGGAAAATTA
GACGTACCAAAAGACTCTAATCAGCTAAGCGGTGGGGAACAAACAAGGATGAAACTCGCTAAATTGTTTACTCATTATTATGAAGCTTTA
TTAATTGATGAGCCGACTACTCACTTAGACCAAGAGGGGATTTCGTTTTTGCTCGATGAACTTAGGTATTACTATGGAGCGCTTGTATTA
ATTAGTCATGACCGTTCTGTATTAGATGAACTAGTTACGACAATTTGGGAAGTTCATGAAGGTAAGGTACGAATCTATTCAGGAAATTAC
AGCGACTACATGGCACAAAAGAAGTTAGAACGTGAACAGCAGAGTCAAGCACATGAACAGTTCATAAAAGAAAAGAGCAGGTTAGAAAAA
GCAGCACAAGAAAAAATGAAGAAAGCTGAAAAAGTTGCACAAGCAGGTCGATTGTCAAAAAAAGATGCGAATGCAAAGCCGGATAAGTCC
TTTATGACAAAATCCAAAGGTACGAGCCAAAAAGCTATGCAGCGTGCAGCAAAGGCCATTGAGCAACGAATGGAAAAACTTCAGGAAGTC
GATGCTGTAAAAGAGGATAGGCAAATAAACTTCCATCAATCGAGAAATTTAGAGCTGCATAATAAATTTCCGATAATGGCAGACCGATTT
ACTCTTCAAGTGGATAACAAAGTATTATTAAATGAAGTAAGTTTTCAAATGCCGCTTGGTAAAAAAATTGCAATTTCGGGTAAAAATGGT
GCTGGCAAAAGTACTTTACTCCACCATATTGCTATCAATGCGCCAGGTTTAACAATTTCACCAAAAGCAAAAATTGGATACTTTCGTCAA
ATGAGCTATCAATATACAAGGGATGAAACGGTATTGGAATTTCTGAAAAATCGTTCTGAATACGATGAGAGATTTTTACGAAGCGTTCTA
CATTCCATGTTGTTTGTCGGCACAGATATATTAAAAAGTGTAAAATCATTAAGTGGTGGTGAAGCGATTCGTCTACAATTATGTCAATTA
TTTTTAGGAGAGTATAATATTTTATTGTTAGATGAACCAACCAATTTTTTAGATATCTATGCTATTGAAGCGTTAGAAAGATTTATTACA
GCATATAAAGGCACTATTATCTTCGTATCACATGATCGCAGGTTTATTGATTGTGTAGCAGATTGTATATATTTCATTGAAGATCAACAG
CTAAAATTAAGGGGTTGA