mecI

Accession ARO:3000124
DefinitionmecI acts as a repressor of transcription of the mecA/mecR1/mecI operon.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs+gi, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs
Resistomes with Sequence VariantsStaphylococcus aureusg+wgs+gi, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs
Classification14 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ gene modulating beta-lactam resistance
+ part_of mec operon
+ regulates mecA
+ regulates mecC
Publications

Blázquez B, et al. 2014. Biochemistry 53(10):1548-50 Regulation of the expression of the β-lactam antibiotic-resistance determinants in methicillin-resistant Staphylococcus aureus (MRSA). (PMID 24564530)

Resistomes

Prevalence of mecI among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Staphylococcus aureus14.8%0%17.98%4.87%
Staphylococcus epidermidis15.79%0%19.07%0%
Staphylococcus haemolyticus0%0%1.56%0%
Staphylococcus hominis18.18%0%25.41%0%
Staphylococcus pseudintermedius27.08%0%29.39%26.67%
Staphylococcus saprophyticus0%0%1.94%0%
Staphylococcus simulans0%0%1.75%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 200


>gb|BAB41258.1|+|mecI [Staphylococcus aureus subsp. aureus N315]
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKV
YKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK


>gb|BA000018.3|+|48894-49265|mecI [Staphylococcus aureus subsp. aureus N315]
ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGCGAATAATATA
ATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGT
AAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATATAAAACATCTAAAAACTTTATCAATAAAGTA
TACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTG
AATAAAAAATAA