mecI

Accession ARO:3000124
CARD Short NamemecI
DefinitionmecI acts as a repressor of transcription of the mecA/mecR1/mecI operon.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesStaphylococcus arlettaeg+wgs, Staphylococcus aureusg+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs
Resistomes with Sequence VariantsStaphylococcus arlettaeg+wgs, Staphylococcus aureusg+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pseudintermediusg+wgs, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs
Classification14 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ gene modulating beta-lactam resistance
+ part_of mec operon
+ regulates mecA
+ regulates mecC
Publications

Blázquez B, et al. 2014. Biochemistry 53(10):1548-50 Regulation of the expression of the β-lactam antibiotic-resistance determinants in methicillin-resistant Staphylococcus aureus (MRSA). (PMID 24564530)

Resistomes

Prevalence of mecI among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Staphylococcus arlettae25%0%2.5%0%
Staphylococcus aureus11.88%0%10.45%0%
Staphylococcus capitis42.86%0%13.07%0%
Staphylococcus epidermidis35.45%0%14.95%0%
Staphylococcus haemolyticus0%0%1.1%0%
Staphylococcus hominis14.29%0%17.95%0%
Staphylococcus lugdunensis3.33%0%1.85%0%
Staphylococcus pseudintermedius24.53%0%21.96%0%
Staphylococcus saprophyticus0%0%2.26%0%
Staphylococcus simulans0%0%1.67%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|BAB41258.1|+|mecI [Staphylococcus aureus subsp. aureus N315]
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKV
YKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK


>gb|BA000018.3|+|48894-49265|mecI [Staphylococcus aureus subsp. aureus N315]
ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGCGAATAATATA
ATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGT
AAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATATAAAACATCTAAAAACTTTATCAATAAAGTA
TACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTG
AATAAAAAATAA