mecC

Accession ARO:3001209
Synonym(s)mecALGA251
DefinitionA foreign PBP2a acquired by lateral gene transfer that able to perform peptidoglycan synthesis in the presence of beta-lactams.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs+gi
Resistomes with Sequence VariantsStaphylococcus aureusg+wgs+gi
Classification12 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ methicillin resistant PBP2 [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ mecI regulates
+ mecR1 regulates
Publications

Garcia-Alvarez L, et al. 2011. Lancet Infect Dis 11(8): 595-603. Meticillin-resistant Staphylococcus aureus with a novel mecA homologue in human and bovine populations in the UK and Denmark: a descriptive study. (PMID 21641281)

Harrison EM, et al. 2013. Antimicrob Agents Chemother 57(3): 1524-1528. A Staphylococcus xylosus isolate with a new mecC allotype. (PMID 23274660)

Paterson GK, et al. 2012. J Antimicrob Chemother 67(12): 2809-2813. The newly described mecA homologue, mecALGA251, is present in methicillin-resistant Staphylococcus aureus isolates from a diverse range of host species. (PMID 22941897)

Milheiriço C, et al. 2017. Antimicrob. Agents Chemother. 61(3): Full-Genome Sequencing Identifies in the Genetic Background Several Determinants That Modulate the Resistance Phenotype in Methicillin-Resistant Staphylococcus aureus Strains Carrying the Novel mecC Gene. (PMID 28069659)

Resistomes

Prevalence of mecC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Staphylococcus aureus0.42%0%0.21%0.29%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1250


>gb|CCC86795.1|-|mecC [Staphylococcus aureus subsp. aureus LGA251]
MKKIYISVLVLLLIMIIITWLFKDDDIEKTISSIEKGNYNEVYKNSSEKSKLAYGEEEIVDRNKKIYKDLSVNNLKITNHEIKKTGKDKK
QVDVKYNIYTKYGTIRRNTQLNFIYEDKHWKLDWRPDVIVPGLKNGQKINIETLKSERGKIKDRNGIELAKTGNTYEIGIVPNKTPKEKY
DDIARDLQIDTKAITNKVNQKWVQPDSFVPIKKINKQDEYIDKLIKSYNLQINTIKSRVYPLNEATVHLLGYVGPINSDELKSKQFRNYS
KNTVIGKKGLERLYDKQLQNTDGFKVSIANTYDNKPLDTLLEKKAENGKDLHLTIDARVQESIYKHMKNDDGSGTALQPKTGEILALVST
PSYDVYPFMNGLSNNDYRKLTNNKKEPLLNKFQITTSPGSTQKILTSIIALKENKLDKNTNFDIYGKGWQKDASWGNYNITRFKVVDGNI
DLKQAIESSDNIFFARIALALGAKKFEQGMQDLGIGENIPSDYPFYKAQISNSNLKNEILLADSGYGQGEILVNPIQILSIYSALENNGN
IQNPHVLRKTKSQIWKKDIIPKKDIDILTNGMERVVNKTHRDDIYKNYARIIGKSGTAELKMNQGETGRQIGWFVSYNKNNPNMLMAINV
KDVQNKGMASYNATISGKVYDDLYDNGKTQFDIDQ


>gb|FR821779.1|-|35681-37678|mecC [Staphylococcus aureus subsp. aureus LGA251]
ATGAAAAAAATTTATATTAGTGTGCTAGTTCTTTTACTAATTATGATTATAATAACTTGGTTATTCAAAGATGACGATATTGAGAAAACA
ATTAGTTCTATTGAAAAAGGAAACTATAACGAAGTATATAAAAATAGTTCAGAAAAATCTAAACTGGCATATGGAGAAGAAGAAATTGTA
GATAGGAATAAAAAAATTTACAAAGATTTAAGTGTCAATAACTTAAAAATTACTAATCATGAAATTAAAAAAACTGGAAAAGATAAAAAG
CAAGTTGATGTTAAATATAACATATATACAAAATATGGAACTATACGACGTAATACACAATTAAACTTTATTTATGAAGATAAGCATTGG
AAATTAGATTGGAGACCAGACGTAATAGTACCTGGTTTGAAAAATGGACAGAAAATTAATATAGAAACATTAAAATCAGAGCGAGGCAAA
ATAAAAGATAGAAATGGTATAGAATTAGCTAAAACTGGAAATACATATGAAATCGGTATTGTCCCTAACAAAACACCCAAAGAAAAATAT
GATGATATTGCTCGTGACTTACAAATTGATACAAAAGCTATAACCAATAAAGTTAATCAAAAATGGGTTCAGCCAGATTCATTTGTACCA
ATTAAAAAGATAAATAAACAAGATGAATATATAGACAAATTAATTAAATCATACAATTTACAAATAAACACTATAAAAAGCCGTGTTTAT
CCATTGAACGAAGCAACAGTACACCTTTTAGGTTATGTGGGTCCAATTAATTCTGACGAGTTAAAAAGTAAGCAATTTAGAAACTATAGC
AAAAATACTGTTATTGGAAAAAAAGGCTTAGAACGCCTCTATGATAAACAATTGCAAAACACTGATGGTTTTAAGGTATCCATTGCAAAT
ACTTATGACAATAAACCTTTAGACACATTATTGGAGAAAAAGGCTGAAAACGGAAAAGATCTTCATTTAACTATAGATGCTAGAGTACAA
GAAAGTATTTATAAACATATGAAAAATGACGATGGATCTGGTACAGCATTACAACCAAAAACTGGAGAAATTTTAGCTTTGGTAAGTACC
CCATCGTACGATGTTTATCCATTCATGAATGGATTAAGCAATAATGACTACCGTAAATTAACTAACAATAAAAAAGAGCCTTTGCTCAAC
AAATTTCAAATCACTACATCACCAGGTTCAACCCAAAAAATATTAACATCTATTATAGCCTTAAAAGAAAATAAACTAGACAAAAATACT
AATTTTGATATTTATGGTAAGGGTTGGCAAAAAGATGCATCATGGGGGAATTATAATATCACAAGATTTAAAGTAGTAGACGGCAATATC
GATTTAAAGCAAGCAATAGAATCATCAGACAACATATTTTTTGCCCGCATTGCATTAGCATTAGGAGCCAAAAAATTTGAGCAAGGTATG
CAAGATTTGGGAATCGGTGAAAATATCCCGAGTGATTATCCCTTTTATAAAGCACAAATCTCAAATAGTAATTTAAAAAATGAAATATTA
TTAGCAGATTCAGGATATGGCCAAGGCGAGATACTAGTAAACCCTATACAAATTTTATCAATATACAGTGCTTTAGAAAATAACGGAAAT
ATACAAAATCCTCATGTTTTACGTAAAACAAAATCTCAAATATGGAAAAAAGATATTATACCTAAAAAAGACATAGATATATTAACTAAT
GGTATGGAACGTGTAGTTAATAAAACACATAGGGATGATATATACAAAAATTATGCCCGAATTATTGGTAAATCTGGCACAGCAGAATTA
AAAATGAATCAAGGGGAAACTGGAAGACAAATAGGTTGGTTTGTTTCATATAATAAAAATAATCCTAATATGTTAATGGCGATTAATGTT
AAAGACGTTCAAAATAAAGGGATGGCCAGCTATAATGCTACTATATCTGGAAAAGTTTATGATGATTTGTATGATAATGGAAAAACTCAA
TTTGATATAGATCAGTAA