mecR1

Accession ARO:3000215
CARD Short NamemecR1
DefinitionmecR1 is a transmembrane spanning and signal transducing protein which in response to interaction with beta-lactam antibiotics results in upregulation of the mecA/mecR1/mecI operon.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesStaphylococcus arlettaeg+wgs, Staphylococcus aureusg+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pseudintermediusg+wgs, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs
Resistomes with Sequence VariantsEscherichia coliwgs, Klebsiella pneumoniaewgs, Mycobacterium tuberculosiswgs, Pseudomonas aeruginosawgs, Staphylococcus arlettaeg+wgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticusg+wgs, Staphylococcus hominisg+wgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediusg+wgs, Staphylococcus saprophyticuswgs, Staphylococcus schleiferig, Staphylococcus simulanswgs, Staphylococcus warneriwgs
Classification14 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ gene modulating beta-lactam resistance
+ part_of mec operon
+ regulates mecA
+ regulates mecC
Publications

Hiramatsu K, et al. 1992. FEBS Lett 298(2-3): 133-136. Molecular cloning and nucleotide sequence determination of the regulator region of mecA gene in methicillin-resistant Staphylococcus aureus (MRSA). (PMID 1544435)

Resistomes

Prevalence of mecR1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0%0.01%0%
Mycobacterium tuberculosis0%0%0.02%0%
Pseudomonas aeruginosa0%0%0.02%0%
Staphylococcus arlettae25%0%5%0%
Staphylococcus aureus36.56%0.04%36.37%0%
Staphylococcus capitis42.86%0%14.38%0%
Staphylococcus epidermidis49.09%0%39.36%0%
Staphylococcus haemolyticus4.17%0%2.64%0%
Staphylococcus hominis21.43%0%19.49%0%
Staphylococcus lugdunensis6.67%0%1.85%0%
Staphylococcus pasteuri0%0%4.17%0%
Staphylococcus pseudintermedius26.42%0%33.07%0%
Staphylococcus saprophyticus0%0%2.26%0%
Staphylococcus schleiferi14.29%0%0%0%
Staphylococcus simulans0%0%1.67%0%
Staphylococcus warneri0%0%3.51%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1100


>gb|ABQ47844.1|+|mecR1 [Staphylococcus aureus subsp. aureus JH9]
MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNFTFSKDMMNRNVSDTTSSVSHMLDGQQSSVT
KDLAINVNQFETSNITYMILLIWVFGSLLCLFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVK
SQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESILK
CSILKSQHINNVAAQYLLGFNSNIKERVKYIALYDSMPKPNRNKRIVAYIVCSISLLIQAPLLSAHVQQDKYETNVSYKKLNQLAPYFKG
FDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKH
LRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEAN
GWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI


>gb|CP000703.1|+|40849-42606|mecR1 [Staphylococcus aureus subsp. aureus JH9]
GTGTTATCATCTTTTTTAATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATAT
ACTCAAAATATTATGTCACATAAGATTTGGTTATTAGTGCTCGTCTCCACGTTAATTCCATTAATACCATTTTACAAAATATCGAATTTT
ACATTTTCAAAAGATATGATGAATCGAAATGTATCTGACACGACTTCTTCGGTTAGTCATATGTTAGATGGTCAACAATCATCTGTTACG
AAAGACTTAGCAATTAATGTTAATCAGTTTGAGACCTCAAATATAACGTATATGATTCTTTTGATATGGGTATTTGGTAGTTTGTTGTGC
TTATTTTATATGATTAAGGCATTCCGACAAATTGATGTTATTAAAAGTTCGTCATTGGAATCGTCATATCTTAATGAACGACTTAAAGTA
TGTCAAAGTAAGATGCAGTTCTACAAAAAGCATATAACAATTAGTTATAGTTCAAACATTGATAATCCGATGGTATTTGGTTTAGTGAAA
TCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAA
AGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATG
GACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTAAAA
TGCTCTATTTTAAAATCTCAGCACATAAATAATGTGGCAGCACAATATTTACTAGGTTTTAATTCAAATATTAAAGAACGTGTTAAGTAT
ATTGCACTTTATGATTCAATGCCTAAACCTAATCGAAACAAGCGTATTGTTGCGTATATTGTATGTAGTATATCGCTTTTAATACAAGCA
CCGTTACTATCTGCACATGTTCAACAAGACAAATATGAAACAAATGTATCATATAAAAAATTAAATCAACTAGCTCCGTATTTCAAAGGA
TTTGATGGAAGTTTTGTGCTTTATAATGAACGGGAGCAAGCTTATTCTATTTATAATGAACCAGAAAGTAAACAACGATATTCACCTAAT
TCTACTTACAAAATTTATTTAGCGTTAATGGCATTCGACCAAAATTTACTCTCATTAAATCATACTGAACAACAATGGGATAAACATCAA
TATCCATTTAAAGAATGGAACCAAGATCAAAATTTAAATTCTTCAATGAAATATTCAGTAAATTGGTATTACGAAAATTTAAACAAACAT
TTAAGACAAGATGAGGTTAAATCTTATTTAGATCTAATTGAATATGGTAATGAAGAAATATCAGGGAATGAAAATTATTGGAATGAATCT
TCATTAAAAATTTCTGCAATAGAACAGGTTAATTTGTTGAAAAATATGAAACAACATAACATGCATTTTGATAATAAGGCTATTGAAAAA
GTTGAAAATAGTATGACTTTGAAACAAAAAGATACTTATAAATATGTAGGTAAAACTGGAACAGGAATCGTGAATCACAAAGAAGCAAAT
GGATGGTTCGTAGGTTATGTTGAAACGAAAGATAATACGTATTATTTTGCTACACATTTAAAAGGCGAAGACAATGCGAATGGCGAAAAA
GCACAACAAATTTCTGAGCGTATTTTAAAAGAAATGGAATTAATATAA