mecR1

Accession ARO:3000215
DefinitionmecR1 is a transmembrane spanning and signal transducing protein which in response to interaction with beta-lactam antibiotics results in upregulation of the mecA/mecR1/mecI operon.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs+gi, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs
Resistomes with Sequence VariantsKlebsiella pneumoniaewgs, Mycobacterium tuberculosiswgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidisg+wgs+gi, Staphylococcus haemolyticusg+wgs, Staphylococcus hominisg+wgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticuswgs, Staphylococcus schleiferig, Staphylococcus simulanswgs
Classification14 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ gene modulating beta-lactam resistance
+ part_of mec operon
+ regulates mecA
+ regulates mecC
Resistomes

Prevalence of mecR1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Klebsiella pneumoniae0%0%0.01%0%
Mycobacterium tuberculosis0%0%0.02%0%
Staphylococcus aureus41.9%0.05%61.74%5.44%
Staphylococcus epidermidis33.33%0%49.69%2.86%
Staphylococcus haemolyticus5.88%0%3.89%0%
Staphylococcus hominis18.18%0%27.05%0%
Staphylococcus pseudintermedius29.17%0%44.44%26.67%
Staphylococcus saprophyticus0%0%1.94%0%
Staphylococcus schleiferi16.67%0%0%0%
Staphylococcus simulans0%0%1.75%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1100


>gb|ABQ47844.1|+|mecR1 [Staphylococcus aureus subsp. aureus JH9]
MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNFTFSKDMMNRNVSDTTSSVSHMLDGQQSSVT
KDLAINVNQFETSNITYMILLIWVFGSLLCLFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVK
SQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESILK
CSILKSQHINNVAAQYLLGFNSNIKERVKYIALYDSMPKPNRNKRIVAYIVCSISLLIQAPLLSAHVQQDKYETNVSYKKLNQLAPYFKG
FDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKH
LRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEAN
GWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI


>gb|CP000703.1|+|40849-42606|mecR1 [Staphylococcus aureus subsp. aureus JH9]
GTGTTATCATCTTTTTTAATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATAT
ACTCAAAATATTATGTCACATAAGATTTGGTTATTAGTGCTCGTCTCCACGTTAATTCCATTAATACCATTTTACAAAATATCGAATTTT
ACATTTTCAAAAGATATGATGAATCGAAATGTATCTGACACGACTTCTTCGGTTAGTCATATGTTAGATGGTCAACAATCATCTGTTACG
AAAGACTTAGCAATTAATGTTAATCAGTTTGAGACCTCAAATATAACGTATATGATTCTTTTGATATGGGTATTTGGTAGTTTGTTGTGC
TTATTTTATATGATTAAGGCATTCCGACAAATTGATGTTATTAAAAGTTCGTCATTGGAATCGTCATATCTTAATGAACGACTTAAAGTA
TGTCAAAGTAAGATGCAGTTCTACAAAAAGCATATAACAATTAGTTATAGTTCAAACATTGATAATCCGATGGTATTTGGTTTAGTGAAA
TCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAA
AGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATG
GACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTAAAA
TGCTCTATTTTAAAATCTCAGCACATAAATAATGTGGCAGCACAATATTTACTAGGTTTTAATTCAAATATTAAAGAACGTGTTAAGTAT
ATTGCACTTTATGATTCAATGCCTAAACCTAATCGAAACAAGCGTATTGTTGCGTATATTGTATGTAGTATATCGCTTTTAATACAAGCA
CCGTTACTATCTGCACATGTTCAACAAGACAAATATGAAACAAATGTATCATATAAAAAATTAAATCAACTAGCTCCGTATTTCAAAGGA
TTTGATGGAAGTTTTGTGCTTTATAATGAACGGGAGCAAGCTTATTCTATTTATAATGAACCAGAAAGTAAACAACGATATTCACCTAAT
TCTACTTACAAAATTTATTTAGCGTTAATGGCATTCGACCAAAATTTACTCTCATTAAATCATACTGAACAACAATGGGATAAACATCAA
TATCCATTTAAAGAATGGAACCAAGATCAAAATTTAAATTCTTCAATGAAATATTCAGTAAATTGGTATTACGAAAATTTAAACAAACAT
TTAAGACAAGATGAGGTTAAATCTTATTTAGATCTAATTGAATATGGTAATGAAGAAATATCAGGGAATGAAAATTATTGGAATGAATCT
TCATTAAAAATTTCTGCAATAGAACAGGTTAATTTGTTGAAAAATATGAAACAACATAACATGCATTTTGATAATAAGGCTATTGAAAAA
GTTGAAAATAGTATGACTTTGAAACAAAAAGATACTTATAAATATGTAGGTAAAACTGGAACAGGAATCGTGAATCACAAAGAAGCAAAT
GGATGGTTCGTAGGTTATGTTGAAACGAAAGATAATACGTATTATTTTGCTACACATTTAAAAGGCGAAGACAATGCGAATGGCGAAAAA
GCACAACAAATTTCTGAGCGTATTTTAAAAGAAATGGAATTAATATAA