RbpA

Download Sequences

Accession	ARO:3000245
CARD Short Name	RbpA
Definition	RNA-polymerase binding protein which confers resistance to rifampin.
AMR Gene Family	RbpA bacterial RNA polymerase-binding protein
Drug Class	rifamycin antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Sequence Variants	Mycobacterium avium^g+wgs, Mycobacterium colombiense^g+wgs, Mycobacterium intracellulare^g+wgs, Mycobacterium kansasii^g+wgs, Mycobacterium leprae^g+wgs, Mycobacterium lepromatosis^g+wgs, Mycobacterium marinum^g+wgs, Mycobacterium tuberculosis^g+wgs, Mycobacterium ulcerans^g+wgs, Mycolicibacterium fortuitum^g+wgs, Mycolicibacterium septicum^g+wgs, Rhodococcus pyridinivorans^g+wgs+gi, Rhodococcus rhodochrous^g+wgs+gi, Streptococcus lutetiensis^wgs
Classification	8 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic target protection [Resistance Mechanism] + antibiotic target protection protein + antibiotic molecule + rifampin-resistant RNA polymerase-binding protein + rifamycin antibiotic [Drug Class]
Parent Term(s)	5 ontology terms \| Show + confers_resistance_to_antibiotic rifampin [Antibiotic] + confers_resistance_to_antibiotic rifaximin [Antibiotic] + confers_resistance_to_antibiotic rifabutin [Antibiotic] + confers_resistance_to_antibiotic rifapentine [Antibiotic] + RbpA bacterial RNA polymerase-binding protein [AMR Gene Family]
Publications	Newell KV, et al. 2006. Mol Microbiol 60(3): 687-696. The RNA polymerase-binding protein RbpA confers basal levels of rifampicin resistance on Streptomyces coelicolor. (PMID 16629670) Dey A, et al. 2011. Microbiology 157(PT 7): 2056-2071. Molecular insights into the mechanism of phenotypic tolerance to rifampicin conferred on mycobacterial RNA polymerase by MsRbpA. (PMID 21415119)

Resistomes

Prevalence of RbpA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Mycobacterium avium	100%	0%	98.56%	0%	0%
Mycobacterium avium	0%	0%	0%	0%	0%
Mycobacterium colombiense	0%	0%	0%	0%	0%
Mycobacterium colombiense	100%	0%	100%	0%	0%
Mycobacterium intracellulare	0%	0%	0%	0%	0%
Mycobacterium intracellulare	100%	0%	100%	0%	0%
Mycobacterium kansasii	100%	0%	100%	0%	0%
Mycobacterium kansasii	0%	0%	0%	0%	0%
Mycobacterium leprae	100%	0%	100%	0%	0%
Mycobacterium leprae	0%	0%	0%	0%	0%
Mycobacterium lepromatosis	0%	0%	0%	0%	0%
Mycobacterium lepromatosis	100%	0%	100%	0%	0%
Mycobacterium marinum	0%	0%	0%	0%	0%
Mycobacterium marinum	100%	0%	98.11%	0%	0%
Mycobacterium tuberculosis	0%	0%	0%	0%	0%
Mycobacterium tuberculosis	100%	0%	99.09%	0%	0%
Mycobacterium ulcerans	0%	0%	0%	0%	0%
Mycobacterium ulcerans	100%	0%	100%	0%	0%
Mycolicibacterium fortuitum	0%	0%	0%	0%	0%
Mycolicibacterium fortuitum	100%	0%	100%	0%	0%
Mycolicibacterium septicum	0%	0%	0%	0%	0%
Mycolicibacterium septicum	100%	0%	100%	0%	0%
Rhodococcus pyridinivorans	100%	0%	100%	100%	0%
Rhodococcus pyridinivorans	0%	0%	0%	0%	0%
Rhodococcus rhodochrous	100%	0%	100%	100%	0%
Rhodococcus rhodochrous	0%	0%	0%	0%	0%
Streptococcus lutetiensis	0%	0%	2.04%	0%	0%
Streptococcus lutetiensis	0%	0%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200

Protein
DNA

>gb|ADV91011.1|+|RbpA [Mycolicibacterium smegmatis MC2 155]
MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRTHWDMLLERRS
VEELEELLKERLDLIKAKRRGTGS

>gb|HQ203032.1|+|1-345|RbpA [Mycolicibacterium smegmatis MC2 155]
ATGGCTGATCGTGTCCTGCGGGGCAGTCGCCTCGGAGCCGTGAGCTACGAGACCGACCGCAACCATGACCTGGCGCCGCGTCAGGTCGCC
CGCTACCGCACGGATAACGGCGAGGAGTTCGACGTACCTTTCGCCGACGACGCCGAGATCCCCGGTACGTGGCTCTGCCGCAACGGTCTG
GAGGGCACCCTCATCGAGGGTGACGTGCCGGAGCCCAAGAAGGTCAAGCCGCCGCGTACGCACTGGGACATGCTGTTGGAGCGCCGGTCC
GTCGAGGAGCTCGAAGAGCTGCTCAAGGAGCGTCTCGACCTGATCAAGGCCAAGCGGCGCGGAACCGGAAGCTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

RbpA

Prevalence: protein homolog model (view sequences)

Graph