AcrE

Accession ARO:3000499
DefinitionAcrE is a membrane fusion protein, similar to AcrA.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, antibacterial free fatty acids, acridine dye, triclosan, aminoglycoside antibiotic, aminocoumarin antibiotic, macrolide antibiotic, fluoroquinolone antibiotic, carbapenem, monobactam, penam, diaminopyrimidine antibiotic, glycylcycline, phenicol antibiotic, cephamycin, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia colig+wgs, Shigella dysenteriaeg+wgs, Shigella flexneriwgs, Shigella sonneiwgs
Classification28 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Lau SY and Zgurskaya HI. 2005. J Bacteriol 187(22): 7815-7825. Cell division defects in Escherichia coli deficient in the multidrug efflux transporter AcrEF-TolC. (PMID 16267305)

Ma D, et al. 1993. J Bacteriol 175(19): 6299-6313. Molecular cloning and characterization of acrA and acrE genes of Escherichia coli. (PMID 8407802)

Resistomes

Prevalence of AcrE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.07%
Citrobacter freundii0%0%0%
Enterobacter cloacae0%0%0%
Enterococcus faecium0%0%0%
Escherichia coli12.8%0%85.72%
Haemophilus influenzae0%0%0.15%
Klebsiella oxytoca0%0%0.93%
Klebsiella pneumoniae0%0%0%
Salmonella enterica0%0%0.03%
Serratia marcescens0%0%0.23%
Shigella dysenteriae100%0%100%
Shigella flexneri6.06%0%5.97%
Shigella sonnei100%0%99.29%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 675


>gb|AAC76297.1|+|acrE [Escherichia coli str. K-12 substr. MG1655]
MTKHARFFLLPSFILISAALIAGCNDKGEEKAHVGEPQVTVHIVKTAPLEVKTELPGRTNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQ
SLYQIDPATYQANYDSAKGELAKSEAAAAIAHLTVKRYVPLVGTKYISQQEYDQAIADARQADAAVIAAKATVESARINLAYTKVTAPIS
GRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQSVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDEST
GSITLRAVFPNPQHTLLPGMFVRARIDEGVQPDAILIPQQGVSRTPRGDATVLIVNDKSQVEARPVVASQAIGDKWLISEGLKSGDQVIV
SGLQKARPGEQVKATTDTPADTASK


>gb|U00096|+|3413864-3415021|acrE [Escherichia coli str. K-12 substr. MG1655]
ATGACGAAACATGCCAGGTTTTTCCTCCTGCCCTCCTTTATTCTGATCTCCGCGGCTTTAATCGCCGGTTGTAACGATAAGGGAGAAGAG
AAAGCTCACGTCGGTGAACCGCAGGTTACCGTTCATATTGTAAAAACGGCCCCGTTAGAAGTTAAGACTGAATTACCAGGCCGCACCAAT
GCTTATCGTATAGCCGAAGTTCGCCCACAGGTTAGCGGGATCGTACTGAATCGCAATTTCACTGAAGGCAGCGATGTGCAAGCAGGCCAG
TCCCTGTACCAGATCGATCCCGCGACCTATCAGGCAAATTATGACAGCGCGAAAGGCGAACTGGCGAAAAGTGAAGCCGCCGCCGCCATC
GCGCATTTGACGGTAAAACGTTACGTTCCGCTCGTGGGTACGAAATACATCAGCCAGCAGGAGTACGACCAGGCCATTGCTGATGCTCGT
CAGGCCGATGCCGCCGTGATTGCCGCAAAAGCCACAGTCGAAAGCGCTCGCATCAATCTTGCTTATACCAAAGTCACTGCGCCAATTAGC
GGACGTATCGGCAAATCGACTGTGACCGAAGGCGCTCTTGTCACTAATGGGCAAACGACTGAACTGGCGACTGTCCAGCAGCTCGATCCT
ATCTACGTTGATGTGACCCAATCCAGCAACGATTTTATGAGGCTGAAGCAATCCGTAGAGCAAGGAAATTTGCATAAGGAAAACGCCACC
AGCAACGTAGAGTTGGTCATGGAAAACGGTCAAACCTATCCCCTGAAAGGTACGCTGCAATTCTCCGATGTGACCGTTGATGAAAGCACC
GGCTCCATAACCCTACGTGCTGTCTTCCCTAACCCGCAACATACGCTTTTGCCGGGTATGTTTGTGCGTGCACGGATTGATGAAGGCGTC
CAACCTGACGCCATTCTTATCCCGCAACAAGGCGTTAGCCGCACACCGCGTGGTGATGCAACCGTGCTGATTGTTAACGATAAAAGTCAG
GTTGAAGCGCGCCCTGTCGTTGCCAGTCAGGCGATTGGCGATAAATGGTTGATTAGTGAAGGACTGAAATCTGGCGATCAAGTCATTGTC
AGCGGCCTGCAAAAAGCGCGTCCGGGAGAGCAGGTTAAAGCCACTACCGATACCCCCGCAGATACTGCATCGAAGTAA