AcrF

Accession ARO:3000502
DefinitionAcrF is a inner membrane transporter, similar to AcrB.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpenam, cephalosporin, cephamycin, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia colig+wgs, Shigella sonneiwgs
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Lau SY and Zgurskaya HI. 2005. J Bacteriol 187(22): 7815-7825. Cell division defects in Escherichia coli deficient in the multidrug efflux transporter AcrEF-TolC. (PMID 16267305)

Resistomes

Prevalence of AcrF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Acinetobacter nosocomialis0%0%2%
Citrobacter freundii0%0%3.1%
Enterococcus faecium0%0%0%
Escherichia coli12.8%0%85.8%
Klebsiella oxytoca0%0%0.93%
Klebsiella pneumoniae0%0%0%
Pseudomonas aeruginosa0%0%0%
Salmonella enterica0%0%0.43%
Serratia marcescens0%0%0.23%
Shigella dysenteriae100%0%100%
Shigella flexneri6.06%0%5.97%
Shigella sonnei100%0%99.76%
Staphylococcus aureus0.24%0%0.04%
Stenotrophomonas maltophilia0%0%0.33%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1900


>gb|AAC76298.1|+|acrF [Escherichia coli str. K-12 substr. MG1655]
MANFFIRRPIFAWVLAIILMMAGALAILQLPVAQYPTIAPPAVSVSANYPGADAQTVQDTVTQVIEQNMNGIDNLMYMSSTSDSAGSVTI
TLTFQSGTDPDIAQVQVQNKLQLATPLLPQEVQQQGISVEKSSSSYLMVAGFVSDNPGTTQDDISDYVASNVKDTLSRLNGVGDVQLFGA
QYAMRIWLDADLLNKYKLTPVDVINQLKVQNDQIAAGQLGGTPALPGQQLNASIIAQTRFKNPEEFGKVTLRVNSDGSVVRLKDVARVEL
GGENYNVIARINGKPAAGLGIKLATGANALDTAKAIKAKLAELQPFFPQGMKVLYPYDTTPFVQLSIHEVVKTLFEAIMLVFLVMYLFLQ
NMRATLIPTIAVPVVLLGTFAILAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMMEDKLPPKEATEKSMSQIQGALVGIAMVLS
AVFIPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATLLKPVSAEHHENKGGFFGWFNTTFDHSVNHYTNSVGKILGSTGRY
LLIYALIVAGMVVLFLRLPSSFLPEEDQGVFLTMIQLPAGATQERTQKVLDQVTDYYLKNEKANVESVFTVNGFSFSGQAQNAGMAFVSL
KPWEERNGDENSAEAVIHRAKMELGKIRDGFVIPFNMPAIVELGTATGFDFELIDQAGLGHDALTQARNQLLGMAAQHPASLVSVRPNGL
EDTAQFKLEVDQEKAQALGVSLSDINQTISTALGGTYVNDFIDRGRVKKLYVQADAKFRMLPEDVDKLYVRSANGEMVPFSAFTTSHWVY
GSPRLERYNGLPSMEIQGEAAPGTSSGDAMALMENLASKLPAGIGYDWTGMSYQERLSGNQAPALVAISFVVVFLCLAALYESWSIPVSV
MLVVPLGIVGVLLAATLFNQKNDVYFMVGLLTTIGLSAKNAILIVEFAKDLMEKEGKGVVEATLMAVRMRLRPILMTSLAFILGVLPLAI
SNGAGSGAQNAVGIGVMGGMVSATLLAIFFVPVFFVVIRRCFKG


>gb|U00096|+|3415033-3418137|acrF [Escherichia coli str. K-12 substr. MG1655]
ATGGCAAACTTTTTTATTCGACGACCGATATTTGCATGGGTGCTGGCCATTATTCTGATGATGGCGGGCGCACTGGCGATCCTACAATTG
CCCGTCGCTCAGTATCCAACAATTGCACCGCCTGCGGTTTCTGTTTCAGCAAACTATCCGGGCGCTGATGCGCAGACCGTGCAGGATACG
GTGACGCAGGTTATCGAACAGAATATGAACGGTATCGATAACCTGATGTATATGTCCTCCACCAGCGATTCCGCCGGTAGCGTGACAATT
ACCCTTACCTTCCAGTCCGGGACCGATCCTGATATCGCGCAAGTGCAGGTGCAGAACAAACTCCAGCTCGCCACGCCGTTGCTGCCGCAG
GAGGTTCAGCAGCAGGGGATCAGTGTTGAAAAGTCCAGTAGCAGCTATTTGATGGTGGCGGGCTTTGTCTCTGATAACCCAGGCACCACA
CAGGACGATATCTCGGACTATGTGGCCTCTAACGTTAAAGATACGCTTAGCCGTCTGAATGGCGTCGGTGACGTACAGCTTTTCGGCGCA
CAGTATGCGATGCGTATCTGGCTGGATGCCGATCTGCTAAACAAATATAAACTGACACCGGTTGATGTGATTAACCAGTTGAAGGTACAG
AACGATCAGATCGCTGCCGGACAGTTGGGCGGAACGCCAGCGTTACCAGGGCAACAATTGAACGCCTCGATTATTGCTCAGACGCGGTTT
AAAAATCCGGAAGAATTCGGCAAAGTGACCCTGCGCGTAAACAGTGACGGCTCGGTGGTACGCCTGAAAGATGTCGCACGGGTTGAACTT
GGCGGTGAAAACTATAACGTTATCGCTCGTATCAACGGAAAACCGGCGGCGGGCCTGGGGATTAAGCTGGCAACCGGCGCGAATGCTCTC
GATACCGCGAAAGCCATTAAGGCAAAACTGGCGGAATTACAGCCATTCTTCCCGCAGGGAATGAAGGTTCTCTACCCTTATGACACCACG
CCATTCGTCCAGCTTTCTATTCACGAAGTGGTAAAAACGCTGTTCGAAGCCATTATGCTGGTGTTCCTGGTGATGTATCTGTTCTTGCAG
AATATGCGAGCAACGCTGATCCCCACCATTGCGGTACCCGTGGTGTTGTTAGGGACGTTTGCCATCCTCGCCGCTTTTGGTTACTCCATC
AACACACTAACGATGTTCGGGATGGTGCTTGCCATCGGGCTGCTCGTCGATGATGCGATAGTGGTGGTGGAGAACGTCGAGCGCGTGATG
ATGGAGGATAAGCTCCCGCCAAAAGAAGCGACGGAAAAATCGATGTCGCAAATTCAGGGCGCACTGGTGGGTATCGCGATGGTGCTGTCA
GCGGTATTTATTCCGATGGCATTCTTCGGCGGTTCTACTGGGGCAATTTATCGCCAGTTCTCTATCACCATCGTTTCGGCAATGGCGCTT
TCTGTTCTGGTGGCATTGATTCTTACCCCTGCGTTATGTGCAACGCTGCTTAAACCCGTCTCTGCTGAGCATCACGAAAATAAGGGCGGT
TTCTTCGGTTGGTTTAATACCACCTTCGATCATAGCGTTAACCACTACACCAACAGCGTCGGCAAAATCCTCGGATCCACAGGACGATAT
TTACTGATCTATGCGCTGATTGTTGCAGGAATGGTGGTGTTGTTTTTACGTCTTCCGTCTTCCTTCTTACCTGAAGAGGATCAGGGTGTC
TTTCTGACCATGATTCAGTTACCCGCTGGCGCGACGCAAGAGCGGACGCAAAAAGTGTTGGATCAAGTTACGGATTACTATCTGAAGAAC
GAGAAAGCGAACGTTGAAAGTGTCTTTACGGTTAACGGCTTTAGCTTCAGCGGCCAGGCACAAAACGCCGGTATGGCCTTCGTCAGTCTG
AAACCGTGGGAAGAGCGTAATGGTGACGAAAACAGTGCGGAAGCGGTAATCCATCGTGCCAAAATGGAATTGGGCAAGATCCGCGACGGT
TTTGTCATTCCATTCAATATGCCAGCCATTGTTGAACTGGGCACGGCAACGGGTTTCGACTTTGAGTTAATTGATCAGGCTGGGCTGGGT
CACGATGCCCTAACCCAGGCCCGTAACCAGTTGCTTGGTATGGCGGCGCAACATCCTGCCAGCTTAGTCAGCGTGCGCCCTAATGGCCTG
GAAGACACCGCGCAGTTTAAACTGGAAGTTGACCAGGAAAAGGCGCAGGCATTAGGTGTTTCACTTTCTGACATCAATCAGACCATTTCA
ACGGCGCTGGGTGGGACTTACGTTAACGACTTCATCGACCGTGGCCGCGTGAAAAAGTTGTATGTTCAGGCGGATGCCAAATTCCGTATG
CTGCCAGAAGATGTCGATAAACTTTATGTCCGCAGCGCCAACGGCGAAATGGTGCCATTCTCGGCCTTTACCACTTCACATTGGGTGTAT
GGCTCTCCGCGACTGGAACGCTACAACGGTCTGCCGTCAATGGAGATTCAGGGGGAAGCCGCGCCAGGAACCAGTTCCGGCGATGCCATG
GCGTTGATGGAAAACCTTGCGTCAAAATTACCTGCGGGCATTGGTTATGACTGGACGGGTATGTCGTATCAGGAACGCTTATCGGGAAAC
CAGGCTCCCGCTCTGGTAGCAATTTCCTTTGTGGTTGTTTTCCTGTGCCTTGCTGCACTCTATGAAAGCTGGTCAATTCCTGTCTCGGTT
ATGTTGGTAGTGCCGTTAGGGATTGTCGGCGTGCTGCTGGCGGCGACACTCTTTAATCAAAAAAATGACGTCTACTTTATGGTGGGCTTG
CTAACGACAATTGGCTTGTCGGCCAAAAACGCTATTTTGATCGTTGAGTTCGCTAAAGATCTCATGGAGAAAGAGGGTAAAGGTGTTGTT
GAAGCGACACTGATGGCAGTACGTATGCGTCTGCGTCCTATCCTGATGACCTCTCTCGCCTTTATTCTCGGCGTATTACCGCTAGCTATC
AGTAACGGTGCCGGCAGTGGCGCGCAGAACGCTGTGGGTATCGGGGTAATGGGAGGAATGGTCTCTGCAACGTTGCTGGCAATCTTCTTC
GTACCGGTGTTCTTTGTGGTGATCCGCCGTTGCTTTAAAGGATAA