golS

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000504
CARD Short NamegolS
DefinitionGolS is a regulator activated by the presence of golD, and promotes the expression of the MdsABC efflux pump.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classphenicol antibiotic, penicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification15 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ positively_regulates MdsABC
+ antibiotic efflux regulatory protein [AMR Gene Family]
Resistomes with Perfect MatchesSalmonella entericag+wgs
Resistomes with Sequence VariantsSalmonella bongorig, Salmonella entericag+wgs+gi
Publications

Pontel LB, et al. 2007. Mol Microbiol 66(3): 814-825. GolS controls the response to gold by the hierarchical induction of Salmonella-specific genes that include a CBA efflux-coding operon. (PMID 17919284)

Perez Audero ME, et al. 2010. Mol Microbiol 78(4): 853-865. Target transcription binding sites differentiate two groups of MerR-monovalent metal ion sensors. (PMID 20807206)

Resistomes

Prevalence of golS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Salmonella bongori8.33%0%0%0%0%
Salmonella enterica85.36%0%91.1%37.09%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 290


>gb|AAL19308.1|+|golS [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADVNQLHFIRRARDLGFSVAEISDLLNLWNNQSRQSADVKRLAQTHIDE
LDRRIQNMQHMAQTLKALIHCCAGDALPDCPILHTLGQPDDSEPEARTGAVLRRPRRHGLAKRL


>gb|AE006468.2|+|400861-401325|golS [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
ATGAACATCGGTAAAGCAGCTAAAGCATCGAAAGTCTCGGCCAAAATGATTCGCTACTATGAACAGATTGGTCTGATTCCCGCGGCAAGT
CGGACGGATTCCGGCTATCGGGCCTATACCCAGGCTGATGTTAATCAATTGCATTTTATACGCCGCGCGCGCGACCTCGGTTTTTCAGTT
GCTGAAATCAGCGACTTACTGAATCTTTGGAATAACCAGTCGCGGCAAAGCGCTGACGTCAAACGCCTGGCGCAGACGCACATTGATGAA
CTGGACAGACGTATCCAGAACATGCAGCACATGGCGCAAACCCTCAAAGCGCTGATTCACTGCTGCGCCGGCGACGCGCTGCCAGATTGC
CCCATTCTGCATACGCTTGGACAACCTGACGATAGCGAGCCGGAGGCGCGTACCGGAGCGGTATTGCGACGTCCTCGTCGCCACGGACTG
GCAAAGCGTCTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit