mdsA

Accession ARO:3000789
Synonym(s)gesA
DefinitionMdsA is the membrane fusion protein of the multidrug and metal efflux complex MdsABC.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, monobactam, acridine dye, penam, glycylcycline, macrolide antibiotic, antibacterial free fatty acids, phenicol antibiotic, carbapenem, triclosan, aminoglycoside antibiotic, aminocoumarin antibiotic, fluoroquinolone antibiotic, diaminopyrimidine antibiotic, cephamycin, penem, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesSalmonella entericag+wgs
Classification28 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Pontel LB, et al. 2007. Mol Microbiol 66(3): 814-825. GolS controls the response to gold by the hierarchical induction of Salmonella-specific genes that include a CBA efflux-coding operon. (PMID 17919284)

Conroy O, et al. 2010. FEMS Microbiol Lett 308(2): 115-122. Differing ability to transport nonmetal substrates by two RND-type metal exporters. (PMID 20497225)

Resistomes

Prevalence of mdsA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Salmonella enterica86.05%0%55.28%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 770


>gb|AAL19306.1|-|mdsA [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MRRTFKIMLIAGVIAAIGGVIYMAGEALWDKDNAVGPPASAPPPPSVPVAKALSRTLAPTAEFTGFLAAPETVELRSRVGGTLDAISVPE
GRLVSRGQLLFQIDPRPFEVALDTAVAQLRQAEVLARQAQADFDRIQRLVASGAVSRKNADDVTATRNARQAQMQSAKAAVAAARLELSW
TRITAPIAGRVDRILVTRGNLVSGGVAGNATLLTTIVSHNPMYVYFDIDEATWLKALRHTRSDKNPPVVNMGLTTDNGLPYQGVLDFMGN
QMNRSTGTIRARAVIPDPDGMLSPGLFARISLPIGEPRETVLIDDLAVSADQGKNYVLIVGKENQVEYRPVELGQMVDGFRVVTQGVLPG
EKIILKGLVRPGMTVAPRLVPMRQNVTDKQTATLTKADGDSAPKAVRQ


>gb|AE006468.2|-|397058-398284|mdsA [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
ATGCGTAGAACATTCAAAATTATGTTGATAGCCGGCGTCATCGCCGCCATCGGGGGCGTGATTTACATGGCCGGCGAAGCACTATGGGAT
AAAGACAACGCCGTCGGCCCCCCGGCCAGCGCGCCGCCTCCACCGTCGGTACCGGTTGCTAAAGCCCTTAGCCGTACACTCGCGCCTACG
GCGGAATTCACCGGTTTTCTGGCCGCGCCGGAAACCGTGGAGCTGCGTTCGCGCGTGGGAGGAACCCTTGACGCCATCAGCGTTCCGGAA
GGACGTCTGGTAAGCCGCGGACAACTGCTGTTCCAGATCGATCCGCGCCCGTTCGAGGTCGCCCTCGACACCGCCGTCGCGCAATTACGT
CAGGCTGAAGTACTGGCCCGCCAGGCGCAGGCGGATTTCGATCGCATTCAACGACTGGTCGCCAGCGGCGCCGTATCACGTAAAAACGCT
GACGATGTCACCGCCACGCGTAATGCGCGACAGGCGCAGATGCAATCGGCCAAAGCCGCCGTCGCCGCAGCGCGCCTTGAACTCTCCTGG
ACCCGTATTACCGCGCCCATTGCCGGACGCGTTGACCGCATACTGGTGACCCGGGGCAATCTGGTCAGCGGCGGCGTAGCGGGTAACGCC
ACGCTTCTGACGACTATCGTGTCTCACAATCCCATGTATGTGTATTTCGATATTGACGAAGCCACCTGGCTGAAGGCGTTACGGCATACC
CGCTCCGACAAAAATCCACCGGTAGTCAACATGGGGTTAACCACCGATAACGGGCTGCCTTATCAGGGCGTACTCGACTTTATGGGCAAT
CAGATGAACCGCAGCACCGGCACTATCCGGGCACGCGCCGTGATTCCTGACCCCGACGGAATGCTTTCTCCCGGCCTGTTTGCCCGAATC
AGTTTGCCCATCGGCGAGCCGCGGGAAACCGTGCTGATTGACGATCTGGCGGTGAGCGCCGATCAGGGCAAAAACTATGTGCTGATCGTC
GGCAAGGAGAATCAGGTGGAGTATCGTCCGGTTGAGTTGGGACAAATGGTCGATGGATTCCGCGTCGTTACACAGGGAGTACTGCCGGGA
GAAAAAATCATCCTCAAGGGGCTGGTGCGTCCTGGCATGACCGTTGCGCCACGTCTGGTGCCGATGCGGCAGAATGTGACCGACAAACAG
ACCGCGACATTGACTAAAGCGGACGGCGACAGTGCGCCGAAGGCGGTGCGCCAATGA