TEM-30

Download Sequences

Accession	ARO:3000900
Synonym(s)	E-GUER IRT-2 TRI-2
CARD Short Name	TEM-30
Definition	TEM-30 is an inhibitor-resistant beta-lactamase found in E. coli. Confers resistance to amoxycilllin-clavulanic acid, ticarcillin-clavulanic acid, kanamycin, neomycin, and intermediate resistance to mezlocillin and piperacillin.
AMR Gene Family	TEM beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, monobactam
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Escherichia coli^p+wgs, Haemophilus parainfluenzae^g, Klebsiella pneumoniae^p+wgs, Neisseria sicca^wgs, Salmonella enterica^wgs, Shigella flexneri^p+wgs
Resistomes with Sequence Variants	Escherichia coli^p+wgs, Haemophilus parainfluenzae^g, Klebsiella pneumoniae^p+wgs, Neisseria sicca^wgs, Salmonella enterica^wgs, Shigella flexneri^p+wgs
Classification	17 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + beta-lactam antibiotic + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + penicillin beta-lactam [Drug Class] + penicillin with extended spectrum + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + cephalosporin [Drug Class] + first-generation cephalosporin + ampicillin [Antibiotic] + class A beta-lactamase + monobactam [Drug Class]
Parent Term(s)	4 ontology terms \| Show + confers_resistance_to_antibiotic amoxicillin [Antibiotic] + TEM beta-lactamase [AMR Gene Family] + confers_resistance_to_antibiotic ampicillin [Antibiotic] + confers_resistance_to_antibiotic cefalotin [Antibiotic]
Publications	Belaaouaj A, et al. 1994. FEMS Microbiol Lett 120(1-2): 75-80. Nucleotide sequences of the genes coding for the TEM-like beta-lactamases IRT-1 and IRT-2 (formerly called TRI-1 and TRI-2). (PMID 8056297) Vedel G, et al. 1992. J Antimicrob Chemother 30(4): 449-462. Clinical isolates of Escherichia coli producing TRI beta-lactamases: novel TEM-enzymes conferring resistance to beta-lactamase inhibitors. (PMID 1490918) Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of TEM-30 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Escherichia coli	0%	0.09%	0.27%	0%	0%
Escherichia coli	0%	0.09%	0.27%	0%	0%
Haemophilus parainfluenzae	6.25%	0%	0%	0%	0%
Haemophilus parainfluenzae	6.25%	0%	0%	0%	0%
Klebsiella pneumoniae	0%	0.01%	0.04%	0%	0%
Klebsiella pneumoniae	0%	0.01%	0.05%	0%	0%
Neisseria sicca	0%	0%	7.69%	0%	0%
Neisseria sicca	0%	0%	7.69%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Shigella flexneri	0%	0.4%	0.16%	0%	0%
Shigella flexneri	0%	0.4%	0.16%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|CAD24670.1|+|TEM-30 [Escherichia coli]
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLG
RRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSSGIIAALGPDGKPSRIVVIYTTGSQATMDE
RNRQIAEIGASLIKHW

>gb|AJ437107.1|+|209-1069|TEM-30 [Escherichia coli]
ATGAGTATTCAACATTTTCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAA
GTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCC
GAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGT
CGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTA
TGCAGTGCTGCCATAACCATGAGTGATAACACTGCTGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTG
CACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATG
CCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAG
GCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCT
AGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAA
CGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

TEM-30

Prevalence: protein homolog model (view sequences)

Graph