TEM-176

Accession ARO:3001041
CARD Short NameTEM-176
DefinitionTEM-176 is a beta-lactamase.
AMR Gene FamilyTEM beta-lactamase
Drug Classpenam, penem, cephalosporin, monobactam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter amalonaticuswgs, Citrobacter portucalensiswgs, Escherichia colip+wgs, Klebsiella pneumoniaewgs, Salmonella entericap+wgs, Shigella flexnerip
Resistomes with Sequence VariantsCitrobacter amalonaticuswgs, Citrobacter portucalensiswgs, Escherichia colig+p+wgs, Klebsiella pneumoniaewgs, Salmonella entericap+wgs, Shigella flexnerip+wgs
Classification17 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ TEM beta-lactamase [AMR Gene Family]
Publications

Barguigua A, et al. 2013. Microb Pathog 61-62: 16-22. Prevalence and types of extended spectrum beta-lactamases among urinary Escherichia coli isolates in Moroccan community. (PMID 23643553)

Resistomes

Prevalence of TEM-176 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Citrobacter amalonaticus0%0%3.64%0%
Citrobacter portucalensis0%0%0.9%0%
Escherichia coli0.02%0.04%0.11%0%
Klebsiella pneumoniae0%0%0.01%0%
Salmonella enterica0%0.05%0.09%0%
Shigella flexneri0%3.21%0.16%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ADB90239.1|+|TEM-176 [Escherichia coli]
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLG
RRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSVLPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDE
RNRQIAEIGASLIKHW


>gb|GU550123.1|+|145-1005|TEM-176 [Escherichia coli]
ATGAGTATTCAACATTTTCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAA
GTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCC
GAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGT
CGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTA
TGCAGTGCTGCCATAACCATGAGTGATAACACTGCTGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTG
CACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATG
CCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAG
GCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGTCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCT
CGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAA
CGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA