SHV-2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001060
CARD Short NameSHV-2
DefinitionSHV-2 is an extended-spectrum beta-lactamase found in E. coli., Klebsiella pneumoniae, and Shigella flexneri.
AMR Gene FamilySHV beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (24), Escherichia coli (20), Salmonella (7), Enterobacteriaceae (3), Salmonella enterica (3), Klebsiella oxytoca (2), Escherichia coli K-12 (2), Serratia marcescens (2)
GAZCroatia (3), French (2), Japan (2), Republic of China (2)
FOODONchicken (2), swine (2), poultry drumstick (2), pork meat food product (2)
ENVOhospital (4), farm (2)
UBERONanimal hemisphere (2)
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ SHV beta-lactamase [AMR Gene Family]
Sub-Term(s)
4 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor_of
+ clavulanic acid [Adjuvant] is_small_molecule_inhibitor_of
+ avibactam [Adjuvant] is_small_molecule_inhibitor_of
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesCitrobacter werkmaniiwgs, Escherichia coliwgs, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Raoultella planticolawgs, Salmonella entericawgs
Resistomes with Sequence VariantsCitrobacter werkmaniiwgs, Escherichia coliwgs, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Raoultella planticolawgs, Salmonella entericawgs
Publications

Bradford PA. 1999. Antimicrob Agents Chemother 43(12): 2960-2963. Automated thermal cycling is superior to traditional methods for nucleotide sequencing of bla(SHV) genes. (PMID 10582889)

Podbielski A, et al. 1991. J Gen Microbiol 137(3): 569-578. Molecular characterization of a new plasmid-encoded SHV-type beta-lactamase (SHV-2 variant) conferring high-level cefotaxime resistance upon Klebsiella pneumoniae. (PMID 2033379)

Resistomes

Prevalence of SHV-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter werkmanii0%0%2.56%0%0%
Escherichia coli0%0%0.04%0%0.09%
Klebsiella michiganensis0%0.57%0.8%0%0%
Klebsiella pneumoniae0%0.01%0.2%0%0%
Klebsiella quasipneumoniae0%0%0.39%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0%0%0.02%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AAD37413.1|+|SHV-2 [Escherichia coli]
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERK
IHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARGIVALLGPNNKAERIVVIYLRDTPASMAERN
QQIAGIGAALIEHWQR


>gb|AF148851.1|+|6-866|SHV-2 [Escherichia coli]
ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAA
CTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAA
CGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAG
ATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCC
GCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTACTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAG
ATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCC
AGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGAT
CGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCGAGCGGGGTGCGCGCGGG
ATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAAT
CAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit